KEGG   Methylacidiphilum infernorum: Minf_1408Help
Entry
Minf_1408         CDS       T00727                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
min  Methylacidiphilum infernorum
Pathway
min00473  D-Alanine metabolism
min00550  Peptidoglycan biosynthesis
min01100  Metabolic pathways
min01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:min00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Minf_1408 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Minf_1408 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Minf_1408 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:min01011]
    Minf_1408 (ddlA)
Enzymes [BR:min01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Minf_1408 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:min01011]
 Precursor biosynthesis
  Amino acid ligase
   Minf_1408 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 TTL ATPgrasp_ST GARS_A RimK PG_binding_2
Motif
Other DBs
NCBI-ProteinID: ACD83462
UniProt: B3DVV9
LinkDB All DBs
Position
complement(1313152..1314063)
Genome map
AA seq 303 aa AA seqDB search
MNPALPRHIAVLKGGPSEEREISLRTAKAVEDALSSLGYEISSIDVTTEKFEIPRDAEIC
FLCIHGSFGEDGQIQRLLMRRGIPFTGSDASSSEKAFDKAWSKTLFIKGGIPTPPFCVVG
DGKKIPFDPPYVIKPSRQGSSIGIEFVYDIKELDQAIKKSTQYDHVVLAEALITGKELTV
GILDGKALPVVEIKPKEGFYDYHHKYTKGASTYFCPAPLTVDQTSAVQKTALDAFNVLGC
SVYGRVDIILSDNGIPWVLEINTIPGMTETSLFPMAAKASGMNFAQLCEKILEISYLRWK
AHG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgctttgcccaggcacattgctgttttaaaaggaggaccttcagaagaaagg
gaaatatctcttcgaaccgcaaaggccgttgaagatgctctttcttctctcggctacgaa
atcagttccattgacgtgacaactgaaaagttcgaaatccctagggatgcggaaatctgc
tttttatgcatccatggctcatttggagaagatggacaaatacagaggcttttaatgcgt
cgaggcattccttttacgggaagtgatgcttcctcgagcgaaaaagcttttgataaagct
tggagcaaaacccttttcatcaagggaggtatccctactcctcctttttgtgtcgttgga
gatggaaaaaaaatcccttttgatcccccttacgtgatcaagccctcgcggcaaggttcg
agcataggcattgagttcgtttatgatattaaagagctggatcaagccattaaaaaatcg
acccaatacgaccatgtggtcttggctgaagcgctgataacgggtaaagaattaaccgtg
gggattctggatggaaaagcccttcccgttgttgaaattaaaccaaaagaggggttttat
gactatcaccataagtataccaagggagcatcaacctatttttgccccgctcccttaacc
gtagatcaaacatcggcggtacagaaaacggctcttgatgcattcaatgtgcttgggtgc
tctgtatatggaagagtagacattatcctctctgataatggcattccttgggttctagaa
atcaatacgataccgggaatgaccgaaacaagcttattcccgatggcagcaaaagcttcc
ggcatgaattttgcccaactttgcgaaaaaatcctggagatttcttaccttaggtggaaa
gcccatggataa

DBGET integrated database retrieval system