KEGG   Methylacidiphilum infernorum: Minf_1693Help
Entry
Minf_1693         CDS       T00727                                 

Gene name
gatA
Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
min  Methylacidiphilum infernorum
Pathway
min00970  Aminoacyl-tRNA biosynthesis
min01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:min00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Minf_1693 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:min03029]
    Minf_1693 (gatA)
Enzymes [BR:min01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Minf_1693 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Minf_1693 (gatA)
Mitochondrial biogenesis [BR:min03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Minf_1693 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACD83747
UniProt: B3DWT4
LinkDB All DBs
Position
1580839..1582323
Genome map
AA seq 494 aa AA seqDB search
MKLFELSVKELRRLLVQKEVSPLEVVENLLCRIAEVDPKIFAYIYLNHERALEASKKADI
SLPLGGVPVAIKDNINVLGEPCRCASRILEGYLAPYDSTVIEKLKKAGAILLGRTNMDEF
AMGSSTENSSVGITRNPWNTERVPGGSSGGSAAAVAAHEAFCALGSDTGGSIRQPAAFCG
CVGLKPTYGRVSRYGLTAFASSLDQIGPITKTVEDAALLLEVISGFDPFDNTSEKLPVPR
FSELLENRPLKDFVLGIPKEYFIEGIDGEVRQALSQVIGHYEKLGVKIEEVSLPHTPYAV
ATYYILATAEASANLARFDGIRYGKRAKNYNDLIDYYGKTRDEGFGSEVKRRILLGTYVL
SSGYYDAYYLRALKVKEKIKQDFSLAFQKCQALLTPTSPFCAFRIGEKTSDPLQMYLADI
FTIAVNLAGICALSIPCGRSTEGLPIGFQLIGPAWKEETILALGYIYQKTTGWVPPLPPL
GGPTGGGGADGLPL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattgtttgaactttcagtcaaagagcttcggaggcttcttgttcaaaaagaagtc
agtccgttggaagttgttgaaaacctcctttgcagaatagcggaagtcgaccccaagatt
ttcgcttacatctatctcaaccatgaaagagcccttgaagcttccaagaaagcagacatt
tctcttcccctgggaggtgtgcccgtagccataaaagacaacattaacgtgcttggcgag
ccttgccggtgcgcttcccgtatcctggagggttacctcgctccttacgatagcaccgtc
atcgagaagttaaaaaaagcgggagccattttgctgggaagaacaaacatggatgaattc
gccatgggatcttccacggaaaattcttcggtggggataacccgcaacccctggaatacc
gagagagtccctggaggaagtagtggaggttctgctgcggcggtcgccgcccatgaagcc
ttctgtgcccttggaagcgatacgggaggctccattcgccagcctgctgctttttgtggt
tgcgttggactcaagcccacctacgggagagtctctcgatatggcctgacggcttttgct
tccagtttagaccagatcggaccgataacgaagaccgtcgaagatgccgccttactcctc
gaggtcatctcgggcttcgatccctttgacaacacttctgaaaagctacccgtcccccgt
ttttcggagctgctcgagaaccgtcctcttaaagactttgtgctgggaatacccaaggag
tatttcatcgagggcattgacggggaagtacgccaagccctcagccaagtcatcggccat
tatgaaaagctaggggtaaaaattgaagaagtttccttaccccatactccttatgcggtc
gccacttattatattcttgccactgccgaagcctccgccaatctggccaggttcgatggt
atccgctacgggaaacgggccaaaaattacaacgatctcatcgattattacggcaaaaca
agggatgaaggttttggctccgaagtcaaaaggagaattctgcttggaacttatgtcctg
agctcgggctattacgatgcctattacctgcgtgctttaaaggtcaaggaaaagattaag
caggacttttccttggcttttcaaaaatgccaagccctcttaacccccacctcgcccttt
tgtgcttttcgcattggtgaaaaaacaagcgatcccttgcagatgtacttagccgatata
tttacgatcgccgttaatcttgcggggatttgtgccctctctattccctgtggacgatcc
accgaaggattgcccatcgggttccagctcatcggaccggcatggaaagaagaaactatt
ttggctttaggttatatttatcagaaaaccacgggttgggttccacccctaccccctcta
ggaggaccaacgggtggagggggtgccgatggcctacccctgtag

DBGET integrated database retrieval system