KEGG   Methylacidiphilum infernorum: Minf_1839Help
Entry
Minf_1839         CDS       T00727                                 

Gene name
putA
Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00146  phenylacetaldehyde dehydrogenase [EC:1.2.1.39]
Organism
min  Methylacidiphilum infernorum
Pathway
min00360  Phenylalanine metabolism
min01100  Metabolic pathways
min01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:min00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Minf_1839 (putA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    Minf_1839 (putA)
Enzymes [BR:min01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.39  phenylacetaldehyde dehydrogenase
     Minf_1839 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACD83893
UniProt: B3DXU1
LinkDB All DBs
Position
complement(1715610..1717148)
Genome map
AA seq 512 aa AA seqDB search
MAKEVLMLTETSTEKSQALSYSLLPKVQDFLKSPKKLFIGGNWVDAVSGKTFPTYDPATG
EVLAFVAEADKEDVDKAVKAAREAFEKGPWSKMTPAERGKLIWKLADLIEENLEELAQVE
SLDNGKPMSVARVADLPLSIDLFRYMSGWATKIEGETIPFSLASPEKFFAYTRREPIGVV
GQIIPWNFPLLMAAWKLGPALATGCTVVLKPAEQTPLSALWLGELIQQAGFPDGVVNILP
GFGETAGAAIASHMDIDKVAFTGSTEVGKIIVKAATSNLKKVSLELGGKSPNIIFADADL
STAIPGAASAIFFNHGQCCCAGSRLYIEKKAFDKVLAGITEEAKKIRLGPGLEPSTEMGP
LVSQEQYDRVFSYIRSGMDEGATVVTGGKRYGEKGYFITPTIFTGVNPSMKIVNEEIFGP
VVCAAPFEDTEEITPVANQTIYGLAAGIWTRDISKAHRLASKLKAGTVWINCYNVFDASL
PFGGYKQSGWGREMGHAVLENYLETKTVCIQL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaggaggtattgatgctaacagaaacttcaactgaaaaatcccaggccttatca
tacagtcttttacccaaggttcaggactttcttaagtctccaaaaaagttatttatcggc
ggcaattgggtagatgccgtctccggaaaaacgtttccaacctatgatcccgctacggga
gaagtactagcctttgtagccgaagccgataaagaggacgtggataaagcggttaaagcg
gctagggaagcttttgaaaaaggaccgtggagcaaaatgacgcctgccgaaaggggcaag
ttaatatggaagcttgccgatttgatcgaagaaaacctggaagagttagcccaagttgaa
tctttggacaacggtaaacccatgtccgtggccagggttgcagacctccccttgtccatc
gatcttttccggtacatgtcgggatgggcgacgaaaatagaaggggagacgatccctttt
tccctggcttctccagaaaaattttttgcttatacaaggagagaacctattggagtagtg
gggcagatcattccttggaattttcccttgttgatggctgcttggaaattaggccctgca
ttagctacgggttgcacggttgttctcaagccggccgaacaaacccctctttccgctttg
tggctaggggagcttattcagcaagccggtttccccgacggggttgttaatattttgccc
ggttttggtgaaacggcgggtgcggcgatcgcttctcacatggatatcgacaaggttgca
tttaccggttcaacagaagtgggcaagattatcgttaaagcggcaacttcaaatctgaaa
aaggtcagtcttgaactcgggggcaaatctccaaacatcatctttgccgatgcagatttg
tcaacggctattccgggagccgcttccgccatattttttaatcatggccaatgttgctgt
gcaggaagcaggctttatatagaaaagaaagcttttgataaagtcctggcgggaataacc
gaagaggctaaaaaaattcgccttggccctggtcttgaaccctcgacggagatgggacct
cttgtttcccaagaacaatacgacagggttttttcttacattcgttccggaatggatgaa
ggagcgaccgtagttaccggggggaagcgctatggagagaaaggctattttataactccc
accatttttaccggggtgaatccctccatgaaaattgtgaatgaggaaatttttggaccc
gttgtttgtgctgctccttttgaagataccgaagagattaccccggtggccaaccagacc
atatacggccttgcggcaggaatatggacaagagatatttcaaaagcccatcggctcgcc
tcaaaactgaaagcgggaacggtctggataaattgttataatgtttttgatgcctcttta
ccttttggaggttataaacagtcgggatgggggagagaaatggggcatgcggtactcgag
aactacctggaaacaaaaaccgtctgtattcaactttaa

DBGET integrated database retrieval system