KEGG   Mixta intestinalis: C7M51_01299Help
Entry
C7M51_01299       CDS       T06391                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mint  Mixta intestinalis
Brite
KEGG Orthology (KO) [BR:mint00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7M51_01299 (ahpF)
Enzymes [BR:mint01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7M51_01299 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_3 Thi4 DAO NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin DSBA
Motif
Other DBs
NCBI-ProteinID: QHM71017
LinkDB All DBs
Position
1386127..1387695
Genome map
AA seq 522 aa AA seqDB search
MLDTTMKNQLKAYLEKLTKPVELIATLDDGAKSAEIKELLGEIAELSEKVTFRIDNSLPV
RKPSFLITNPGSTTGPRFAGSPLGHEFTSLVLALLQTGGHPSKETQALLDQIRQLDDDLH
FETYYSLSCHNCPDVVQALNLMAILNPRISHTAIDGGVFQNEIQDRNVMGVPAVFLNGKE
FGQGRMSLTEIVSKVDVNADKRAADELNKRDAYDVLIIGSGPAGAAAAIYSARKGIRTAL
LGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVSEYAIDVIDSQSASKLVPASVEG
GLHAIETASGALLKSRSIIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPAMKADAVLQQKVRSLENVDIILNAQTLEVKGD
GSKLTSLEYKDRVNETVHQLDVAGIFVQIGLLPNTTWLDGTVERNQMGEILIDAKCETNI
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTQPVG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccacgatgaaaaaccaactcaaggcctatcttgagaaattaactaagcct
gttgagttaatcgccacgctggacgacggcgccaaatccgctgaaattaaagaactgctg
ggcgaaatcgctgaactgtcagagaaagtcacgttccgcatagataattctctgccggtg
cgtaagccctcctttttgattactaacccaggcagcactaccggcccgcgttttgccggt
tcgccgctgggtcacgaatttacctcgctggtgctggcgctgctgcaaaccggcgggcat
ccgtctaaagagacgcaggcgctgctggatcagatccgccagctggatgatgacctgcac
tttgaaacctattactcgctttcctgccacaactgcccggacgtagtgcaggcgctgaac
ctaatggcaattcttaacccgcgcatcagccacacggcgatcgatggcggcgtgttccag
aatgagattcaggatcgcaacgtaatgggcgttccggcggtattcctgaatggcaaagag
ttcggccagggccgcatgagcctgacggaaatcgtcagcaaagtagacgttaacgccgac
aaacgtgcggcggatgagctgaacaagcgcgacgcctatgacgtactgattatcggcagc
ggcccggcgggtgcggcagcggcaatctactccgcacgtaaaggtatccgcaccgcactg
ctcggcgagcgtttcggcgggcaggtgctggatacggtcgatattgaaaactatatctcc
gtaccgaaaaccgaaggcgctaagctggcaggcgcgctgaaagcgcacgttagcgaatac
gccatcgacgtaatcgacagccagagcgccagcaaactggttccggccagcgttgaaggc
ggcctgcatgcgattgaaaccgcctctggcgcgctgctgaaatcacgcagcattatcatc
gctaccggtgcgcgctggcgcaacatgaacgtaccgggcgaagatcagtatcgtacccgt
ggcgttacctactgcccgcactgtgacggcccgctgtataaaggcaagcgcgtggcggta
atcggcggcggcaactccggcgtggaagcggcgatcgatctggccggtatcgttgagcac
gttaccctgcttgagttcgcgccagcgatgaaagcggacgcggtactgcaacagaaagtt
cgcagcctggaaaacgtggatatcatccttaacgcccagacgctggaagtgaaaggcgac
ggcagcaagctgaccagcctggaatataaagatcgcgttaacgagacggtacatcagctg
gacgtggcggggatctttgttcagattggtctgctgccgaatacgacctggctggacggc
acggttgaacgtaatcagatgggcgaaatccttatcgatgcgaagtgcgaaactaatatt
aaaggcgtgtttgccgccggtgactgtaccaccgttccgtacaagcagattatcatcgcc
agcggcgaaggcgcaaaagcctcgctcagcgcgtttgattacctgattcgtacgcagccg
gttggctaa

DBGET integrated database retrieval system