KEGG   Mixta intestinalis: C7M51_01307
Entry
C7M51_01307       CDS       T06391                                 

Gene name
cheY_1
Definition
(GenBank) Chemotaxis protein CheY
  KO
K07315  phosphoserine phosphatase RsbU/P [EC:3.1.3.3]
Organism
mint  Mixta intestinalis
Brite
KEGG Orthology (KO) [BR:mint00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mint03021]
    C7M51_01307 (cheY_1)
Enzymes [BR:mint01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     C7M51_01307 (cheY_1)
Transcription machinery [BR:mint03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     C7M51_01307 (cheY_1)
SSDB
Motif
Pfam: SpoIIE Response_reg Lipase_3
Other DBs
NCBI-ProteinID: QHM71025
LinkDB
Position
complement(1392804..1394024)
AA seq 406 aa
MPTDQTILIVDDSTTYRKLIAGLLKKWGYSVYEAENGEDALRALLSWPINLMISDWEMPV
MDGLTLCRRVRAQFSDRYIYLILLTARESIDDLRAGFEAGANDFLRKPVNQIELQARLHA
GQRILDLELMLAARNARLSEALKQIETDLQAAARLQQSILPAHNLRNGDYRADWLFVPSA
YVSGDIFNFFPLNERYAGFYGVDVAGHGVGAAMVSLAVARQFLHGRTVEPFLFTAGQPTP
PHEVVRILNQRFCAENDEVLSYFTMVYGVLDTRSGEGRLCQAGHPTPLIVRASGEVIAVG
EGGMPVGMMEGLTWDEQTFLLATGDRLCLYSDGITECENPQHELFGQHRLEALLIKEAQT
PLPQLFPHISAALIHWRAEAEALEATVTDDISLFIIEHHPLSEEKR
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgccaactgaccagaccatcctgatcgtcgatgattccactacctaccgcaagctgatt
gccggactgctgaagaagtggggctatagcgtctatgaggcggagaacggtgaagatgcg
ctgcgggcgctgctgagctggccgatcaatttgatgatcagcgactgggagatgccggta
atggacggcctgacgctctgccgccgggtgcgcgcccagttcagcgatcgctatatctat
ctgatactgcttaccgcccgcgaaagtatcgacgatctgcgtgccggatttgaggcaggt
gccaatgatttcctgcgcaagccggttaatcagattgagcttcaggcgcgcctgcatgcc
gggcagcgcatcctcgatctggaactgatgctggcagcgcgcaatgcgcgtcttagcgag
gcgctgaagcagattgaaaccgatttacaggctgccgccaggctacagcagtcgatcctg
cctgcccataacctgcgcaatggggactatcgcgccgactggctgtttgtaccctccgcc
tatgtttccggcgatatcttcaatttcttcccgctcaacgagcgatacgctggtttttac
ggtgttgatgtcgccgggcatggcgtcggtgcggcgatggtttcgctggcggtggcgcga
cagtttttgcatggccgcaccgtggaaccctttctgtttaccgccggacagccgacgccg
ccgcatgaggtggtgcgcattctgaatcagcgcttctgcgccgaaaatgatgaggtgctg
agctatttcaccatggtgtatggcgtgctggatacgcgcagcggagaagggcgactttgc
caggcgggacatccaacgccgttaatcgtgcgcgccagcggtgaggttattgcggtgggc
gaaggcggcatgccggttggaatgatggaagggctgacctgggatgaacaaacctttctg
ctggcgacgggcgaccggctctgcctctacagcgacggcattaccgagtgtgaaaatccg
cagcatgagctgtttggtcagcatcggctggaagcgctgctgataaaagaagcgcaaacg
ccgctgccgcagctgtttccacacatcagcgcggcgttaatccactggcgcgccgaagcg
gaagcgctggaagcaacggttaccgatgatatttccctgtttattattgaacatcacccc
ctgtcagaggaaaaacgatga

DBGET integrated database retrieval system