KEGG   Mixta intestinalis: C7M51_02946
Entry
C7M51_02946       CDS       T06391                                 

Definition
(GenBank) hypothetical protein
Organism
mint  Mixta intestinalis
SSDB
Motif
Pfam: DUF1525 Thioredoxin_2 RPN13_C Thioredoxin_3
Other DBs
NCBI-ProteinID: QHM72628
LinkDB
Position
complement(3182178..3182579)
AA seq 133 aa
MKLRHFIFLSALLPTTVLAGTVLYTDSQHLPENLSPDVVVVLLDEPERLQLKMFGQLSAD
PELATLQAKQVMSSPQWQQKQQQLVTAYRQVVHARELGIRKVPAVVFNDRDVVYGTTDVV
RATELRQQAGGGQ
NT seq 402 nt   +upstreamnt  +downstreamnt
atgaaattacgtcattttatctttctgtcggcgcttctgccgacgacggtgctggcgggc
acggtgctttataccgacagccagcatttacctgaaaatctttccccggatgtcgtagtt
gttttgctggatgagcctgagcgcctgcagttgaaaatgtttggtcagctttcggctgac
ccggagctggcaacattgcaggcaaaacaggtgatgtcctccccccagtggcaacaaaaa
cagcagcagttggtcacggcatatcgccaggtagtgcatgcacgggaactcggcatccgc
aaggtgcccgctgtcgtttttaacgatcgggatgtagtttacggcactaccgatgtggta
cgggctacagagctgcgtcagcaggcaggaggtggacagtga

DBGET integrated database retrieval system