KEGG   Mixta intestinalis: C7M51_04359Help
Entry
C7M51_04359       CDS       T06391                                 

Definition
(GenBank) hypothetical protein
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
mint  Mixta intestinalis
Pathway
mint01100  Metabolic pathways
mint01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mint00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    C7M51_04359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mint01004]
    C7M51_04359
   01008 Polyketide biosynthesis proteins [BR:mint01008]
    C7M51_04359
Enzymes [BR:mint01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     C7M51_04359
Lipid biosynthesis proteins [BR:mint01004]
 Polyketide synthase
  Component type
   C7M51_04359
Polyketide biosynthesis proteins [BR:mint01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     C7M51_04359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc Polyketide_cyc2
Motif
Other DBs
NCBI-ProteinID: QHM73998
LinkDB All DBs
Position
unnamed1:10898..11623
Genome map
AA seq 241 aa AA seqDB search
MERNFDLNLAKKDITNLFFELGLIQSVTDNINPSDSLRKKYDLDSQELMTLLDLVSSLAI
NHSPLQEEEVITVDDLIRFLAVNRDDWLFNDVPYIMQGSVLLNKDVETVYSYIKDYRNWP
GIINHVIKIDSEYDDGRLQTFSMYIDEFGSGKEYHVKSMRYLNSQAGIIDFAQPLPPEGF
RCHKGGWRFISGNDNQTRLVSYHGFSLNKGVDPEGPLAMIRKHMNVALSTWARHSSGDTS
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaatttcgatttaaatttggcaaaaaaagacattaccaacctgttttttgaa
ctcggcctcattcaatctgttactgataatatcaaccctagtgatagtctcagaaaaaaa
tatgatctggatagtcaggaattaatgacgcttctggatcttgtatcatcactagcaata
aaccactcgccacttcaagaagaagaggttattacggttgatgatctaatccgatttcta
gctgtaaatcgtgacgactggttgtttaacgacgtaccctatataatgcaaggaagtgtc
cttttaaataaggatgtggaaactgtttattcttatattaaagattatagaaattggcct
ggaattattaaccatgttattaaaattgactcagagtatgatgacggccgcttacagact
ttttccatgtatattgatgaattcggttctggaaaagaatatcacgtgaaatccatgcgt
taccttaattctcaagccggtatcattgactttgctcaacctttaccgccagaaggtttt
cgttgtcataaaggtgggtggcgatttatttctggcaatgataatcagacccgcttggtt
agttaccacggattttcccttaataaaggtgtggacccggaaggaccgctggccatgatc
cgtaaacatatgaatgtggctctcagtacttgggcacgacacagcagtggtgatacgagt
gaataa

DBGET integrated database retrieval system