KEGG   Microbacterium sp. No. 7: AOA12_02310Help
Entry
AOA12_02310       CDS       T04102                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00330  Arginine and proline metabolism
mio01100  Metabolic pathways
mio01110  Biosynthesis of secondary metabolites
mio01130  Biosynthesis of antibiotics
mio01230  Biosynthesis of amino acids
Module
mio_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AOA12_02310
Enzymes [BR:mio01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AOA12_02310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA NAD_binding_2 IlvN NAD_Gly3P_dh_N PDH
Motif
Other DBs
NCBI-ProteinID: ALJ18806
UniProt: A0A0P0E428
LinkDB All DBs
Position
509858..510688
Genome map
AA seq 276 aa AA seqDB search
MTLPAVAILGVGAMGGAILHGLVASGIEVQGGIRISDQWSERVAELSRADGVTGFDGAAD
PRANHRAAEGAGVVIVAVKPHQIRDLLTDIGDALAEDATVISIAAGVPTEVLEAHLPASV
AVVRVMPNSPARVRAGVTGIAAGARAGERDLERARELFATIGEVLVVDEDRIDALTSISG
SGPAYVFHFIEKFVEAARARGFSDADAKLLVEGTVRGAVDLLTATGEDPAVLRRQVTSPG
GTTQAALEVLDAADLGTILDAATRAAVVRAAELAAG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcccgcggtggccattctcggtgtcggcgcgatgggcggcgccatcctgcac
gggctcgtcgcctcggggatcgaggtgcagggcggcatccgcatctccgaccagtggtcg
gagcgcgtcgccgagctgagccgggccgacggtgtcacgggcttcgacggcgccgccgac
ccgcgggccaaccatcgcgccgcggagggcgcgggcgtcgtgatcgtcgcggtcaagccg
caccagatccgcgacctgctcaccgacatcggcgacgcgctcgccgaggatgccacggtc
atctccatcgccgcgggcgtgccgaccgaggtgctcgaggcgcacctgccggcatccgtc
gccgtcgtgcgggtcatgcccaactcgccggcgcgcgtgcgcgcgggagtcacgggcatc
gcggcgggcgcccgcgcgggcgagcgcgacctcgagcgcgcgcgggagctgttcgcgacg
atcggcgaggtgctcgtcgtcgacgaggaccgcatcgacgcgctcaccagcatctccggg
tcgggtccggcctacgtcttccacttcatcgagaagttcgtcgaggcggcccgcgcccgc
ggcttctccgacgctgacgcgaagctgctcgtcgagggcaccgtgcgcggcgccgtcgac
ctgctcaccgcgacgggcgaggaccccgccgtgctgcgccggcaggtgacgagccccggc
ggcacgacgcaggccgcgctcgaagtgctcgacgccgccgacctgggcacgatcctggat
gccgcgacgcgcgccgccgtcgtgcgcgcggccgagctcgccgccggctga

DBGET integrated database retrieval system