KEGG   Microbacterium sp. No. 7: AOA12_07875Help
Entry
AOA12_07875       CDS       T04102                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00620  Pyruvate metabolism
mio00680  Methane metabolism
mio01100  Metabolic pathways
mio01120  Microbial metabolism in diverse environments
mio01200  Carbon metabolism
Module
mio_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOA12_07875
  09102 Energy metabolism
   00680 Methane metabolism
    AOA12_07875
Enzymes [BR:mio01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AOA12_07875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALJ19828
UniProt: A0A0P0EEK8
LinkDB All DBs
Position
complement(1704408..1707152)
Genome map
AA seq 914 aa AA seqDB search
MRDLTVTEAIDVVGRGEAEHELPGPLRADVRMLGGLLGRVLRESGSEGLFDDVERLRHAT
IAAYTDDSPQAFARAEEIADSFDVQRADEVARAFTAYFHLVNLAEEHQRVRVLRERDGRP
EARDAKDSVASAYARLTGEIGAEAATERLQQLRFHPVFTAHPTEARRRAVSMSIRRLAAL
LIEHDRAAHDAAQRDGADDAAPEQVRGDADGAERLSSEQRRLQRLMLQEIDTLWRTAPLR
AEKPTPVDEVRAVMAIFDDTLYMTIPQVYRRVDDVLQGGDAGARAPLVKPFVRVGTWVGG
DRDGNPFVTASVTKKAAAIASEHILLGLEHTAERVARSLTLSGDSTPPSTALLALWQRLS
DADEDAAVEVAKRAPDEPHKRVLMLLTRRLAATRARNADLAYADPDPFLADLRTVQDSLV
AAGAPRQAYGELQHLIWQVETFGFHLAELEVRQHSAVHAKVLAECEAGEPLSPLAEEVLE
VFRTIAQLQRRYGPRAAGRYIVSFTQSAADLAAVHRLARFAVGEQGTPPVLDVIPLFETF
ADLQAAPAIMAEIIEHPAFAERLAATGRRLEVMLGYSDSSKDVGPVAANLALYEAQALIA
EWARENGIQLTLFHGRGGALGRGGGPANSAVLAQPPHSVEGRFKLTEQGEVIFARYGDPD
IAMRHIDQVAAAVLLASAPSYAALNREAAERFADVAATMDAASRAKFFELVKAPGFAPWF
ATVTPMEEIGLLALGSRPARRGLSVESLADLRAIPWVFAWSQARINLAGWFGLGTALEAV
GDEELLRGAYDEWPLLRTIIDNIGMSLAKSDVRIARRYLDLGDRDDLAALVLDELELTQR
WVVRIVGGDDLLANKPVLQRAVKMRDPYVDALSLLQLRALRALRTASDDQDVTPWQHLLL
LSVSGVAAGLQNTG
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatctcacggtgacggaagcgatcgacgtcgtcggccgcggcgaggccgagcac
gagctgcccggccccctgcgcgccgacgtgcggatgctcggcggcctgctgggccgcgtg
ctgcgcgagagcggctcggaggggctcttcgacgacgtcgagcggctgcggcacgcgacg
atcgccgcctacaccgacgactcgccgcaggcgttcgcccgcgccgaggagatcgccgac
tcgttcgacgtgcagcgcgccgacgaggtcgcgcgcgcgttcaccgcctacttccacctc
gtcaacctcgccgaggagcaccagcgcgtgcgcgtgctgcgcgagcgcgacggccgcccc
gaggcgcgggacgccaaggactccgtcgcatcggcgtacgcgcggctgaccggtgagatc
ggcgccgaggccgcgaccgagcgcctgcagcagctgcgcttccacccggtgttcacggcg
caccccaccgaggcgcggcggcgcgccgtgtccatgagcatccgccgtctcgcggccctg
ctcatcgagcacgatcgcgccgcgcacgacgccgcccagcgcgacggcgcggacgacgcg
gcgccggagcaggtccgcggggacgccgacggggccgagcgcctcagctcggagcagcgc
cgtctgcagcggctcatgctgcaggagatcgacacgctgtggcgcacggcgcccctgcgc
gccgagaagcccacgcccgtcgacgaggtgcgcgcggtcatggcgatcttcgacgacacc
ctgtacatgacgatcccgcaggtgtaccggcgcgtcgacgacgtgctccagggcggcgac
gcgggagcgcgggcgcccctcgtgaagcccttcgtgcgcgtgggcacctgggtcggcggc
gatcgcgacggcaacccgttcgtgacggcgtcggtgaccaagaaggccgccgccatcgcc
tcggagcacatcctcctgggcctcgagcacacggccgagcgcgtcgcgcgctccctcacg
ctctccggcgactcgacgccgccgtcgaccgcgctgctggcgctgtggcagcggctctcc
gacgccgacgaggatgccgccgtcgaggtcgccaagcgcgcccccgacgagccgcacaag
cgcgtgctcatgctgctcacgcggcgcctcgccgcgacgcgggcgcgcaacgccgacctc
gcctacgccgaccccgatccgttcctcgccgatctgcgcacggtgcaggactcgctcgtc
gccgcgggcgcgccgcgccaggcctacggagagctgcagcacctgatctggcaggtcgag
acgttcggcttccacctcgccgagctcgaggtgcggcagcactcggccgtgcacgcgaag
gtgctcgccgaatgcgaggcgggcgaaccgctcagcccgctcgccgaggaggtgctcgag
gtcttccgcacgatcgcgcagctgcagcgccggtacgggccgcgcgccgcgggccgctac
atcgtgtcgttcacgcagtcggccgccgacctcgccgccgtgcaccggctggcgcgcttc
gccgtcggcgagcagggcaccccgcccgtgctcgacgtcatcccgctgttcgagaccttc
gccgacctgcaggccgcgcccgcgatcatggccgagatcatcgagcaccccgcgttcgcg
gagcggctcgccgcgaccggccgccgcctggaggtcatgctcggctactccgactcgtcg
aaggacgtcggccccgtcgccgcgaacctcgcgctctacgaggcgcaggcgctcatcgcc
gagtgggcgcgcgagaacggcatccagctgacgctgttccacggccggggcggcgccctc
ggacgcggcggcggccccgcgaactccgccgtgctcgcgcagccgccgcactcggtcgag
ggccggttcaagctcaccgagcagggcgaggtgatcttcgcccgctacggcgaccccgac
atcgcgatgcgccacatcgaccaggtcgcggccgccgtgctgctggcctcggcgccgtcg
tacgcggcgctcaaccgcgaggccgcggagcggttcgccgacgtcgccgcgacgatggac
gccgcgtcgcgcgcgaagttcttcgagctcgtgaaggcgcccggcttcgcgccgtggttc
gcgaccgtcacgccgatggaggagatcggcctgctggcgctgggctcgcggcccgcgcgc
cgcggcctgtcggtcgagtcgctcgccgacctgcgcgcgatcccgtgggtgttcgcgtgg
tcgcaggcgcggatcaacctggccggatggttcgggctcggcaccgccctggaggcggtc
ggcgacgaggagctgctgcgcggcgcgtacgatgagtggccgctgctgcgcaccatcatc
gacaacatcggcatgagcctcgccaagagcgacgtgcgcatcgcccgccgctacctcgac
ctcggcgaccgcgacgacctggccgcgctcgtgctcgacgagctcgagctcacgcagcgc
tgggtcgtgcgcatcgtcggcggcgacgacctgctcgccaacaagcccgtgctgcagcgg
gcggtgaagatgcgcgacccctacgtcgacgcgctctcgctgctgcagctgcgcgccctg
cgcgcgctgcgcaccgcgtcggacgaccaggacgtcacgccgtggcagcacctgctgctg
ctgtcggtgagcggcgtcgcggccggcctgcagaacaccggctga

DBGET integrated database retrieval system