Microbacterium sp. No. 7: AOA12_10000 Help Entry AOA12_10000       CDS       T04102                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism mio  Microbacterium sp. No. 7 Pathway mio03060   Protein export mio03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mio00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AOA12_10000  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AOA12_10000  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mio02044]     AOA12_10000 Secretion system [BR:mio02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AOA12_10000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ALJ20226 UniProt:  A0A0P0EBF9 LinkDB All DBs Position complement(2157361..2157606) Genome browser AA seq 81 aa AA seqDB search MSNLFAGPHLWIILIVILLLFGAAKLPALAKSMGQSARIFKGEMKAMKDDETQGTAQNTA ADTPPAGPENPPAPPASDPKS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcaatctcttcgcaggtccgcacctgtggatcatcctgatcgtcatcctgctgctg ttcggtgccgccaagcttcccgccctggcgaagagcatgggccagtccgcccgcatcttc aagggcgagatgaaggcgatgaaggacgacgagacgcagggtacggctcagaacaccgcg gccgacaccccgccggccggccccgagaacccgccggctccgcccgccagcgaccccaag tcatag

DBGET integrated database retrieval system