KEGG   Microbacterium sp. No. 7: AOA12_14805Help
Entry
AOA12_14805       CDS       T04102                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00010  Glycolysis / Gluconeogenesis
mio00030  Pentose phosphate pathway
mio00051  Fructose and mannose metabolism
mio00052  Galactose metabolism
mio00680  Methane metabolism
mio01100  Metabolic pathways
mio01110  Biosynthesis of secondary metabolites
mio01120  Microbial metabolism in diverse environments
mio01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOA12_14805
   00030 Pentose phosphate pathway
    AOA12_14805
   00051 Fructose and mannose metabolism
    AOA12_14805
   00052 Galactose metabolism
    AOA12_14805
  09102 Energy metabolism
   00680 Methane metabolism
    AOA12_14805
Enzymes [BR:mio01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AOA12_14805
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AOA12_14805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase UPF0261
Motif
Other DBs
NCBI-ProteinID: ALJ21103
UniProt: A0A0N7I446
LinkDB All DBs
Position
complement(3125581..3126609)
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGTTTYDIEFVGIRDGWRGVVDGDFFPLSRHEVKGL
AKTGGTILGTSRTNPYEGPRGGAENISKTLFGHRIDGIIAIGGEGTLAAADRLHKDGIPV
LGVPKTIDNDLRATDYSFGFDTAVNIATDAMDRLRTTGDSHQRCMVAEVMGRHVGWIALH
SGIAAGAHVICIPEKPMSIEEVCQQVSKAHDRGRAPLVVVSEGFTLTGQAEAYSDKGLDA
FNRPRLGGIGEVLAPEIERITGIETRATVLGHIQRGGSPSAFDRVLATRLGLHAADAVHD
GAWGQMVSLKGTDIVRVPFADALGELNTVPLYRYDEAAALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcattctcaccagcggtggcgactgtcccggcctgaacgccgtgatccgc
ggcgcggtgctcaagggaaccaccacgtacgacatcgagttcgtcggcatccgcgacggc
tggcgcggcgtcgtcgacggcgacttcttcccgctctcgcggcacgaggtgaagggcctg
gccaagaccggcggcacgatcctcggcacgagccgcaccaacccctacgaggggccccgc
ggcggcgccgagaacatctccaagacgctgttcggccaccgcatcgacggcatcatcgcg
atcggcggcgagggcacgctcgcggccgccgaccggctgcacaaggacggcatccccgtg
ctcggcgtgccgaagacgatcgacaacgacctgcgcgccaccgactactcgttcggcttc
gacacggccgtcaacatcgcgaccgacgcgatggaccggctgcgcacgacgggcgactcg
caccagcgctgcatggtcgccgaggtcatgggccggcacgtcggctggatcgcgctgcac
tcgggcatcgcggcgggtgcccacgtgatctgcatccccgagaagccgatgtcgatcgag
gaggtctgccagcaagtgtcgaaggcccacgaccgcggccgtgcgcccctcgtcgtcgtc
tcggagggcttcaccctcacgggccaggccgaggcgtacagcgacaagggcctcgacgcc
ttcaaccgcccgcggctcggcggcatcggcgaggtgctcgcgcccgagatcgagcgcatc
acgggcatcgagacccgcgcgaccgtgctcggccacatccagcgcggcggctcgccctcg
gccttcgaccgcgtgctcgccacgcgcctcggcctgcacgccgccgacgcggtgcacgac
ggcgcgtggggccagatggtctcgctcaagggcaccgacatcgtgcgcgtgcccttcgcc
gacgccctcggcgagctcaacaccgtccccctctaccgctacgacgaggccgccgcgctg
ttcggctga

DBGET integrated database retrieval system