KEGG   Microbacterium sp. No. 7: AOA12_16115Help
Entry
AOA12_16115       CDS       T04102                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AOA12_16115
Enzymes [BR:mio01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AOA12_16115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M DUF4434 Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_35 Cellulase
Motif
Other DBs
NCBI-ProteinID: ALJ21343
UniProt: A0A0N7I476
LinkDB All DBs
Position
complement(3416403..3418463)
Genome map
AA seq 686 aa AA seqDB search
MTARAAAHRWVRPGALGAGGLRYGADYNPEQWPRDVWHEDMRLMREAGVNIVSLGIFSWA
LLEPRPGEWDFGWLDEVMDLLHDNGIDVDLATATASPPPWLTRLHPEVLPVTADETVLYP
GGRQHWRPTSPVFRRYALRLVRALAERYRDHPALVAWHISNELGCHNAFDYSDDAAAAFR
VWLRGRYGTLDALNDAWGTAFWSQHYGAWDEILPPRIAAAQRNPGRQLDFERFSSDALRE
HLRAEAAVLAEVTPDVPRTTNFMVCQNIRDIDYATWAGDVDFVSNDHYLRPGELGRDDLS
FWANLTGNLAEGHPWFLMEHATSAVNWREVNPPKRAGELRRDALTHVGHGADAVCYFQWR
QSRAGGERYHSAMVPHAGADSRVFRDVVALGAELRALAPVAGSHRERARVALLFDYESWW
VSGRDSHPSDALRYDAETLTWYRALLDRGVRVDVLPVHAAFEGYEVVIAPMLHVVPDGLR
RRLEEVVLDGRHVLATYFSGVVDEHDRVWLGGYPGGLRDLLGVTVEEFVPLLPGTRVRLS
SGAVATTWTERITRVGADVEVIDTYADGDLAGGPAVTRRRVGGGSATYVSADVARAGAVD
LLRAWAAEVDALRGEPLAADGRLETIVRAKGGTRFVFLANRTDEAVDVPVTGERVGAGGA
GAERAGTEPVWRIGPGEVAIVAQPGS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccgtgcggcggcgcaccgctgggtgaggcccggcgccctcggcgcgggcggg
ttgcgctacggcgccgactacaaccccgagcagtggccgcgcgacgtgtggcacgaggac
atgcgcctcatgcgcgaggccggcgtgaacatcgtctcgctcgggatcttctcgtgggcg
ctcctggagccgcggccgggggagtgggacttcggctggctcgacgaggtcatggacctg
ctgcacgacaacggcatcgacgtcgacctcgccaccgccacggcctccccgccgccctgg
ctgacgcgcctgcacccggaggtgctgcccgtgaccgccgacgagacggtgctctacccg
ggcgggcggcagcactggcgccccacctcgcccgtcttccgacgctacgctctgcggctc
gtgcgcgcgctcgcggagaggtatcgcgaccacccggcgctcgtcgcgtggcacatctcc
aacgagctgggatgccacaacgcgttcgactactccgacgacgcggccgcggcgttccgc
gtgtggctgcgggggcgatacggcacgctcgacgccctcaacgacgcgtgggggaccgcc
ttctggtcgcagcactacggtgcctgggacgagatcctgccgcctcgcatcgcggccgcg
cagcgcaaccccggacgacagctcgacttcgagcggttctcctccgacgccctgcgcgag
cacctccgcgccgaggcggcggtgctcgccgaggtgacgcccgacgtgccgcgcacgacc
aacttcatggtgtgccagaacatccgcgacatcgactacgccacgtgggcgggcgacgtc
gacttcgtctcgaacgaccactacctgcgtcccggcgagctcgggcgcgacgacctctcg
ttctgggcgaacctgaccggcaacctggcggaggggcatccctggttcctcatggagcac
gcgaccagcgccgtcaactggcgtgaggtcaacccgccgaagcgcgcgggcgagctgagg
cgcgacgccctcacgcacgtggggcacggcgcggacgccgtctgctacttccagtggcgc
cagtcgcgcgccggcggcgagcgctaccattccgcgatggtgccgcacgccggagccgac
agtcgggtgttccgcgacgtcgtcgcgctgggcgccgagctgcgcgcgctcgcgccggtc
gccggctcgcaccgcgagcgggcgcgcgtcgccctgctcttcgactacgagtcctggtgg
gtgagcgggcgcgactcgcatccgagcgacgcgctgcgctacgacgccgagaccctgacg
tggtaccgggcgctgctcgaccgcggcgtccgcgtcgacgtgctgcccgtgcacgccgcg
ttcgagggctacgaggtcgtcatcgcacccatgctgcacgtcgtgcccgacgggctgcgg
cgtcgtctggaggaggtcgtcctcgacgggcggcacgtgctcgcgacgtacttctcgggc
gtggtcgacgagcacgaccgcgtgtggctcggcggctatcccggcgggctgcgcgacctg
ctcggcgtgaccgtcgaggagttcgtcccgctgctgccgggcacgcgcgtgcggctctcc
tcgggcgcggtcgcgacgacctggaccgagcggatcacgcgcgtcggcgccgacgtcgag
gtgatcgacacgtacgccgacggcgatctggctggcggccccgccgtcacgcgaaggcgg
gtgggcggcggttccgcgacctacgtgtcggccgacgtcgcgcgcgcaggcgccgtcgac
ctgctgcgggcgtgggccgccgaggtcgacgcgctgaggggcgagccgctcgcggcggac
ggacgcctcgagacgatcgtgcgcgccaagggcgggacgcggttcgtgttcctcgccaac
cgcaccgacgaggccgtcgacgtgcccgtgaccggcgagcgggtcggggccggtggggcc
ggtgcggagcgcgcggggacggagccggtctggcggatcggccccggcgaggtcgcgatc
gtcgcgcagccggggtcgtag

DBGET integrated database retrieval system