KEGG   Microbacterium sp. No. 7: AOA12_17175Help
Entry
AOA12_17175       CDS       T04102                                 

Definition
(GenBank) MFS transporter
Organism
mio  Microbacterium sp. No. 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 Herpes_US9 Phage_holin_2_3
Motif
Other DBs
NCBI-ProteinID: ALJ21529
UniProt: A0A0P0EE88
LinkDB All DBs
Position
3642456..3643865
Genome map
AA seq 469 aa AA seqDB search
MTSAHAGPGVESVPIARVIMISATAALAGFLFGFDTAVINGAVGAIRDQFEVDGFVLGFS
VAAALIGCAIGAWFTGRIADRYGRVRVMIIAAIIFVVSSIGCGFAIGIVDLTLWRLFGGL
GVGAASVIAPVYIAEVSPPAYRGRLGSLQQMAIVVGIFVALLTDAVIVAAAGSASNPWLF
GLEAWRWMFLSEVVPAVLYGVLALTIPESPRFLIGAGMREKAIGVLRRYVGGNPEKTADE
IAETFVGREAPRLSILKGRALGLQPIVWVGIGLSVLQQFTGINVIFYYSSILWQAVGFTE
QDSLTITVITSVTNIVTTIVAIALIDKIGRRPLLLVGAIGQFLTLGTLAIVFATAPVIDG
APVLEGAASPIALVAANLFVVFFGATWGPVVWVLLGEMFPNRIRVVALSVAAAAQWAANF
IISTTFPALAAVGLGLAYGVYTFFAFVAIFFVVRFVKETRGRTLEEISR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccgcacacgccggcccgggagtcgagtcggttcccatcgcccgggtcatcatg
atctcggcgacggccgcgctcgccgggttcctgttcggcttcgacaccgccgtgatcaac
ggcgccgtcggcgccatccgggatcagttcgaggtcgacgggttcgtgctcggcttctcc
gtcgccgcggccctgatcggctgcgccatcggcgcgtggttcacggggcgcatcgccgac
cggtacgggcgcgtgcgggtgatgatcatcgccgcgatcatcttcgtcgtcagctcgatc
ggatgcggcttcgcgatcggcatcgtcgatctgacgctgtggcgcctgttcggcggcctg
ggcgtcggcgcggcatccgtcatcgcccccgtgtacatcgccgaggtgtcgccgcccgcc
tatcgcggccggctcggatcgctgcagcagatggcgatcgtcgtcggcatcttcgtcgcg
ctgctcaccgacgccgtgatcgtcgcagcggccggcagcgcgtcgaacccctggctcttc
ggcctcgaggcctggcgctggatgttcctctccgaggtcgtgcccgcggtcctctacggc
gttctcgcgctcacgatccccgagtcgccgcgcttcctcatcggcgcgggcatgcgcgag
aaggccatcggcgtgctgcgccgctacgtcggcggcaacccggagaagaccgcggacgag
atcgccgagaccttcgtcgggcgcgaggcgccgcgcctctcgatcctcaagggccgggcg
ctcggcctgcagcccatcgtgtgggtcggcatcggcctctcggtgctgcagcagttcacc
ggcatcaacgtcatcttctactactcgtcgatcctgtggcaggcggtcggcttcaccgag
caggactcgctgaccatcaccgtgatcacatcggtcaccaacatcgtgacgacgatcgtc
gcgatcgcgctgatcgacaagatcgggcgcagacccctgctgctcgtcggcgcgatcggg
cagttcctcacgctcggcacgctcgcgatcgtcttcgcgaccgcccccgtgatcgacggc
gcgcccgtgctggagggcgccgcgtcgcccatcgcgctcgtcgcggcgaacctgttcgtc
gtcttcttcggcgccacgtggggtccggtcgtgtgggtgctgctcggagagatgttcccc
aaccgcatccgcgtcgtcgcgctgtccgtcgccgcggccgcgcagtgggccgcgaacttc
atcatctccaccacgttccccgcgctcgcggcggtcggtctcgggctggcgtacggcgtc
tacacgttcttcgcgttcgtcgcgatcttcttcgtcgtgaggttcgtgaaggagacgcgc
gggcgcacgctggaggagatctcccgctga

DBGET integrated database retrieval system