KEGG   Microbacterium sp. No. 7: AOA12_18370Help
Entry
AOA12_18370       CDS       T04102                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00010  Glycolysis / Gluconeogenesis
mio00020  Citrate cycle (TCA cycle)
mio00620  Pyruvate metabolism
mio01100  Metabolic pathways
mio01110  Biosynthesis of secondary metabolites
mio01120  Microbial metabolism in diverse environments
mio01130  Biosynthesis of antibiotics
mio01200  Carbon metabolism
Module
mio_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOA12_18370
   00020 Citrate cycle (TCA cycle)
    AOA12_18370
   00620 Pyruvate metabolism
    AOA12_18370
Enzymes [BR:mio01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AOA12_18370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ALJ21750
UniProt: A0A0P0EHX2
LinkDB All DBs
Position
complement(3922576..3923964)
Genome map
AA seq 462 aa AA seqDB search
MAEIIRMPEVLAGAAEAAVQTWLVSVGSVVAVDQPLAEIETDKAIVEFTAEKAGTIGRLL
IAEGDTVAVGDPIVVLLGDGEGDDAIGPALAAAGVADAGVADTRGGGTGDVSVAAEPVVG
VPAPAPSVDEEPAGAVSGGEEPAEAAPDSGRIFATPIVRRLAAQAGVPLADVAGTGPRAR
IVRRDLERHLAALERSGAASRASAEASSAEAGEPASAAASMPTPAAVPASASAAGAGFED
VPLDRMRKAIARRLTESKATVPHFYLVADCRVERLLELRRTVNETAARKISVNDFVLKAV
AAALVEVPAANAIWNVDSIRRFSSVDVSVAVATEGGLTTPVLRGVERMPLGEVSATVADL
AERARAGRLRQHELEGGSFSVSNLGMYGTAQFTAILNPPQSGILAVGAARAVPVVGVDGA
LEAGQVMTVTLSADHRVLDGAVAAEWLAAFQRRIENPLSILI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagatcatccggatgccggaggtgctcgcgggagccgcggaggcggcggtgcag
acgtggctcgtctccgtcggatccgtcgtcgccgtcgaccagcccctcgcggagatcgag
accgacaaggcgatcgtcgagttcaccgccgagaaggcgggcacgatcggccggctgctc
atcgccgagggcgacacggtcgccgtgggcgacccgatcgtcgtcctgctcggcgacggt
gagggcgacgacgcgatcggccccgcgctggccgccgcgggcgtggcggatgcgggtgtg
gcggatacgcgtggcggtgggaccggtgacgtgagcgtcgccgcggagcccgtcgtcggc
gtgcccgcccccgccccgtccgtcgacgaggagcctgccggggccgtgtccggcggcgag
gagcccgccgaggcggcgccggactccggccggatcttcgcgacccccatcgtgcgccgg
ctcgcggcgcaggcgggcgtgccgctcgccgacgtggcgggcacggggccccgcgcgcgc
atcgtgcgccgcgacctggagcggcacctcgccgcgctggagcgatccggggccgcgtcg
cgtgcgtcggcggaggcatcgtcggcggaggcaggggagccggcatccgctgcggcatcc
atgccgacgccggcggcggtgccggcatccgcgagtgcggcgggcgccgggttcgaagac
gtgccgctcgaccgcatgcgcaaggcgatcgcccgccgcctcacggagagcaaggcgacg
gttccgcacttctacctggtcgcggactgccgggtcgagaggcttctcgagctgcggcgc
acggtcaacgagacggcggcgcgcaagatctccgtcaacgacttcgtcctgaaggccgtc
gcggccgcgctcgtcgaggtgcccgccgccaacgcgatctggaacgtcgacagcatccgc
cggttctcgtcggtggacgtctcggtcgccgtggcgaccgagggcgggctgacgacgccc
gtcctgcgcggcgtcgagcggatgccgctcggcgaggtgagcgcgacggtcgccgacctg
gccgagcgcgcgcgtgcgggccggctgaggcagcacgagctcgagggcggcagcttctcg
gtgtcgaacctcggcatgtacggcaccgcgcagttcacggcgatcctgaacccgccgcag
tctggcatcctggcggttggcgcggcgcgggccgtgcccgtcgtcggcgtcgacggcgcg
ctcgaggcgggccaggtgatgaccgtgacgctctccgccgaccatcgcgtgctcgacggc
gccgtcgcggccgaatggctcgcggcgttccagcggcgcatcgagaacccgctgtccatc
ctgatctga

DBGET integrated database retrieval system