KEGG   Microbacterium sp. No. 7: AOA12_19430Help
Entry
AOA12_19430       CDS       T04102                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mio  Microbacterium sp. No. 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALJ21946
UniProt: A0A0P0DPE9
LinkDB All DBs
Position
4163590..4165089
Genome map
AA seq 499 aa AA seqDB search
MTTDTISARDTPLALAHADRLFIDGEWVAPTGSGGFDVIDSATEQPFLRVAEASAADMDA
AIAAARHAFDHTDWSFLEPAERAVYLRRLAEGLRARSEEMATYWTRQAGPLFAMSKGSIQ
RVPMVFEFYADLADSYPWITPGTSMMSEFAAVVSEPIGVVGAIVPWNTPLSLAGYKVAPA
LLTGCTVVLKLPPEAPGELLVLAEVAQEIGLPPGVLNVVTADREVSEQLVRDPRVDKIAF
TGSSAVGKRIATICGERLARYTLELGGKSAAVVLDDYDLQKAAAAITGQEISLTGQNCSS
LTRVIVSRRRHDELAEALGAAFGAVRVGDPFDPASQMGPLAMGRQQARVLEYVEKGVAEG
ATLVTGGRRPAHLERGYFVEPTVFANVDNRSTIAQEEIFGPVVSIIPADDEAHAIELANG
TPFGLNSAVFTDDVERAWHVARRLRAGTVGHNGFKVESLLLGFGGVKQSGFGREGGVQGV
HPYIETKTVLLDGAPRRFQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacacgatctccgcccgcgacacacccctcgccctcgcgcacgccgaccgc
ctcttcatcgacggagagtgggtcgcccccaccggctccggcggcttcgacgtgatcgac
tcggcgaccgagcagcccttcctgcgcgtcgccgaggcgagcgccgccgacatggacgcc
gcgatcgccgcggcgcgccacgcgttcgatcacaccgactggtcgttcctcgagccggcc
gagcgcgccgtctacctgcgcaggctcgccgagggcctgcgcgcccgctccgaggagatg
gcgacctactggacgcggcaggccggcccgctcttcgccatgtcgaaggggtcgatccag
cgcgtgccgatggtgttcgagttctacgccgacctcgccgactcctacccctggatcacc
cccggcacgtcgatgatgtcggagttcgcggcggtcgtcagcgagccgatcggcgtcgtc
ggcgcgatcgtcccctggaacacgccgctgtcgctggcgggctacaaggtcgccccggcc
ctgctcaccggctgcaccgtcgtgctcaagctcccgcccgaggcgccgggcgagctgctc
gtgctcgccgaggtcgcccaggagatcgggctgccgccgggcgtgctcaacgtcgtcacc
gccgaccgcgaggtctccgagcagctcgtgcgcgacccccgcgtcgacaagatcgccttc
acgggatcgagcgccgtcggcaagcgcatcgcgaccatctgcggcgagcgcctcgctcgc
tacacgctcgagctcggcggcaagtcggccgccgtcgtcctcgacgactacgacctgcag
aaggcggccgcggcgatcaccgggcaggagatcagcctcaccggccagaactgctcgtcg
ctcacgcgcgtcatcgtctcgcggcgccgtcacgacgagctcgccgaggccctcggcgcc
gcgttcggcgccgtgcgcgtgggcgacccgttcgaccccgcgtcgcagatgggccccctc
gcgatgggacgtcagcaggcgcgcgtgctcgagtacgtcgagaagggcgtcgccgagggc
gcgacgctcgtcacgggcgggcgccggcccgcgcacctggagcgcggctacttcgtcgag
cccacggtcttcgcgaacgtcgacaaccggtcgaccatcgcgcaggaggagatcttcggc
cccgtcgtgtcgatcatccccgccgacgacgaggcgcacgcgatcgagctcgccaacggc
acgcccttcggcctcaactcggcggtcttcaccgacgacgtcgagcgcgcctggcacgtg
gcgcgccgcctccgcgcgggcaccgtcggccacaacgggttcaaggtcgagtcgctgctg
ctcggcttcggcggcgtcaagcagtcaggcttcgggcgcgagggcggcgtccagggcgtc
cacccctacatcgagacgaagaccgtgctcctggacggcgctccccggcggttccagtga

DBGET integrated database retrieval system