KEGG   Microbacterium sp. PAMC 28756: AXH82_00760Help
Entry
AXH82_00760       CDS       T04312                                 

Definition
(GenBank) phosphoenolpyruvate--protein phosphotransferase
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
mip  Microbacterium sp. PAMC 28756
Pathway
mip02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:mip00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    AXH82_00760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mip02000]
    AXH82_00760
Enzymes [BR:mip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     AXH82_00760
Transporters [BR:mip02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    AXH82_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilizers PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: AMG84916
LinkDB All DBs
Position
155793..157418
Genome map
AA seq 541 aa AA seqDB search
MTEALPAPENTPSTAGADTERARVREAVAVVAQELTQRGEAAGGAAQEVLEAQAMIAEDP
TLQDEVDSRIDAGATAEWAVHDAFAGFRATLEAVGGYLGERAADLDDIAQRVLARLRGVE
APGVPDPGHPFVLVARDLAPADTALLNLDQVLALVTTDGGPTSHTAILAREKGIVAVVGV
GDGHALTTGETVIVDAAAGVITREPTDDERARAAERAAARRAADDAPLTPGALADGTPVA
LLANLGKPADAADAVARGAEGVGLFRTEFLFLSASQAPTVAQQRDAYRELLEAFPGKKVV
VRMLDAGADKPLAFLNDAHEENPALGLRGLRALRASEDILREQLTALAEADAATDADLWV
MAPMVATVEETVYFTGLAREYGLKTAGVMVEVPSSALLADRVLAHADFASIGTNDLTQYT
MAADRLLGSVASFQDPWHPAVLRLVREVGAAGARLGKPVGICGEAAADPLLAVVLVGLGA
TSLSMAPSALADVRQALAARTRDDALRLAEAALGADDAPSARTAAATLAAALPPHQKETT
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggcgctgcccgcgcccgagaacacgccgagcaccgcgggggcggacaccgag
cgtgcgcgggtccgcgaggccgtcgccgtcgtggcgcaggagctgacccagcgcggcgag
gccgccggtggtgcggcgcaggaggtgctcgaggcgcaggcgatgatcgccgaggacccc
accctgcaggacgaggtcgacagcaggatcgacgccggcgccaccgcggagtgggccgtg
cacgacgccttcgcgggtttccgggccacgctcgaagccgtcggcggctacctcggtgag
cgcgccgccgatctcgacgacatcgcgcagcgggtgctcgcccggctgcgcggcgtggag
gcccccggcgtgcccgaccctgggcacccgttcgtcctcgtggcgcgtgacctcgcgccc
gccgacaccgcactgctgaacctcgaccaggtgctcgccctcgtcaccaccgacggcggc
ccgacctcccacacggcgatcctcgccagggagaagggcatcgtggccgtggtcggcgtc
ggcgacgggcacgccctgacgaccggggagaccgtgatcgtcgacgcggccgcgggagtc
atcacccgtgagccgaccgatgacgagcgcgcccgcgccgccgagcgcgccgccgcccgc
cgcgccgccgacgacgccccgctcacccccggcgccctcgccgacggcacgccggtcgcg
ctgctcgcgaacctggggaagcccgccgacgccgccgacgcggtcgcgcggggggccgag
ggcgtcggcctgttccggacggagttcctgttcctctccgcgtcgcaggcgccgacggtc
gcccagcagcgggacgcctaccgcgagctcctggaggccttccccggcaagaaggtcgtc
gtgcggatgctcgacgcgggggccgacaagccgctggccttcctcaacgacgcacacgag
gagaacccggccctgggattgcgcggcctgcgggcgctccgcgcgagcgaggacatcctc
cgcgagcagctgaccgcgctggccgaggccgacgccgcgaccgacgccgacctgtgggtc
atggcacccatggtggccaccgtcgaggagaccgtgtacttcaccggtctcgcccgcgag
tacgggctgaagacagccggcgtcatggtcgaggtgccctccagcgccctgctcgccgac
cgggtgctcgcgcacgccgacttcgcatccatcggcaccaacgacctcacgcagtacacg
atggccgcggaccggctgctcggttccgtcgcgtcgttccaggatccctggcaccccgcg
gtgctgcgcctggtgcgcgaggtcggtgcggccggtgcccgtctcggcaagcccgtcggc
atctgcggcgaggccgcggccgatccgctgctcgccgtcgtcctcgtgggcctcggtgcg
acgagcctgtccatggcaccgtccgccctcgccgacgtccgccaggcgctcgccgcccgg
actcgcgacgatgccctccgtctcgcggaagccgcgctcggcgcggacgacgccccctcc
gcccgcaccgctgcggcgaccctcgccgcggcactcccccctcatcagaaagagaccaca
tcatga

DBGET integrated database retrieval system