KEGG   Microbacterium sp. PAMC 28756: AXH82_01125Help
Entry
AXH82_01125       CDS       T04312                                 

Definition
(GenBank) amino acid transporter
  KO
K03293  amino acid transporter, AAT family
Organism
mip  Microbacterium sp. PAMC 28756
Brite
KEGG Orthology (KO) [BR:mip00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AXH82_01125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 PrgI Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: AMG82130
LinkDB All DBs
Position
complement(235791..237182)
Genome map
AA seq 463 aa AA seqDB search
MTTEVPVTTTTTKGLHPGLTRRQISMMGLGGAIGAGLFVGSGQAISIAGPAVLISYLVAG
GIVVLVMAMLAEMVAARPSSGAFSSYAQKAMGRSAGSAVGWLYWIQLVVVIAAEATGAAG
IVANWVPGIPAWVWVLVFVVALTAVNLFGVRNYGRFEFWFAAIKVAAIVAFLVVGVCAII
GLIPGVPATGISNLVDEGGFAPHGITGIAAALLIVVFAFGGTEVVAIAAAESDDPSRNIR
RIVREVLVRILVFYVGSIFVIVAVLPWDDPAVQAGPFSAVLDTLNVPGVGLVMDLIVVIA
LLSAMNANIYGASRMAYSLGERGLAPLSVTRTSLKGVPFVAVLASVAFGFVTVGLNWAFP
DVVLPALLNVVGSTLLVIWTATAISQIVLRRRADRAGEAMPMRLWGFPWVSWLCLVLLAA
VIALAMIDPAARIQLLLTLGLTAVLLVVARLTRGVSRPGIVKE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgaggtccccgtcaccacgacgaccacgaagggcctgcacccgggcctcacc
cgccgccagatctccatgatggggctcggcggcgcgatcggcgcggggctgttcgtcggc
tccgggcaggcgatcagcatcgcgggacccgccgtgctcatctcctacctcgtcgcgggc
ggcatcgtcgtgctcgtgatggcgatgctcgccgagatggtggcggcgcggccgagctcc
ggcgccttcagctcctacgcccagaaggccatggggcgcagcgccggcagcgcggtgggc
tggctgtactggatccagctcgtcgtcgtgatcgccgccgaggcgaccggcgcggccggg
atcgtggcgaactgggtacccgggatccccgcgtgggtgtgggtgctcgtgttcgtcgtg
gcgctcaccgcggtgaacctcttcggcgtgcgcaactacggccgtttcgagttctggttc
gcggcgatcaaggtcgccgcgatcgtcgccttcctcgtcgtcggcgtgtgcgcgatcatc
ggactcatccccggcgtgccggcgaccggcatctcgaacctggtggatgagggcggcttc
gccccgcacggcatcaccggcatcgccgcggcgctcctcatcgtcgtcttcgcgttcggc
ggcaccgaggtcgtcgcgatcgcggccgccgagtcggacgacccctcccgcaacatccgc
cggatcgtgcgcgaggtgctggtgcgcatcctcgtcttctacgtcggctcgatcttcgtc
atcgtcgcggtgctcccgtgggacgaccccgccgtgcaggctggtccgttctcggcggtc
ctggacaccctgaacgtgccgggcgtcggcctcgtgatggacctcatcgtggtgatcgcg
ctgctctcggccatgaacgccaacatctacggcgcctcccggatggcgtactcgctgggg
gaacgcgggctggcgccgctgtccgtcacccggacgagcctcaagggcgtgccgttcgtc
gccgtcctcgcctcggtggccttcggcttcgtgaccgtgggactcaactgggccttcccg
gacgtggtgctcccggcgctgctgaacgtcgtggggtcgaccctgctggtgatctggacg
gcgacggcgatctcccagatcgtgctgcgccggcgggccgaccgtgccggcgaggcgatg
cccatgcggctctggggcttcccctgggtgtcgtggctgtgcctcgtgctgctcgccgcc
gtgatcgcgctcgcgatgatcgacccggctgcgcgcatccagctgctgctcacgctcggg
ctcaccgcggtgctgctcgtcgtcgcccgcctgacgcggggtgtctcccgccccggcatc
gtcaaggagtga

DBGET integrated database retrieval system