KEGG   Microbacterium sp. PAMC 28756: AXH82_02660Help
Entry
AXH82_02660       CDS       T04312                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mip  Microbacterium sp. PAMC 28756
Pathway
mip00250  Alanine, aspartate and glutamate metabolism
mip00280  Valine, leucine and isoleucine degradation
mip00410  beta-Alanine metabolism
mip00640  Propanoate metabolism
mip00650  Butanoate metabolism
mip01100  Metabolic pathways
mip01120  Microbial metabolism in diverse environments
Module
mip_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mip00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AXH82_02660
   00650 Butanoate metabolism
    AXH82_02660
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AXH82_02660
   00280 Valine, leucine and isoleucine degradation
    AXH82_02660
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXH82_02660
Enzymes [BR:mip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AXH82_02660
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AXH82_02660
Amino acid related enzymes [BR:mip01007]
 Aminotransferase (transaminase)
  Class III
   AXH82_02660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMG84946
LinkDB All DBs
Position
complement(552998..554359)
Genome map
AA seq 453 aa AA seqDB search
MALLDTAAPAVPLGGPDLPQERRLVTELPGPRSAEVLARKADAVAAGVGHTVPVAAVAAG
GGVVVDADGNSLIDLGSGIAVTTVGNAHPKVAAAVAAQAAQFTHTCFMISPYESYVGVAE
ALNRVTPGDFAKKSALFNSGAEAVENAIKIARKHTGRQAVVAFDHGYHGRTNLTMALTAK
SMPYKSGFGPFAPEVYRAPMSYPFRDGLEGGEAAARVILQLEKQIGADNLAAVIIEPIQG
EGGFIVPADGFLPAIVDWCRANGVVFIADEVQTGFARTGHMFASEIFGIEPDLITTAKGI
AGGLPLAAVTGRAEIMDASHSGGLGGTYGGNPIACAAALAAIDVFENDGVIERAREIGEI
LIGRLTALQAEDARIGDVRGHGAMVAAEFVDPETKAPDAALTAAVAKACIAQGVIVLTCG
TYGNVIRFLPPLSIGDELLNEGLDVVAEALAGA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctcgacaccgcagcacccgcagtccccctcggcggccccgacctcccgcag
gagcgtcgcctcgtcacggaactccccggcccgcggtcggccgaggtcctcgcccgcaag
gcggacgcggtcgccgccggtgtcggacacaccgtgcccgtcgccgccgtcgcggccggg
ggaggggtggtcgtcgacgccgacggcaactcgctcatcgacctcggctccggcatcgcg
gtgaccacggtcggcaacgcgcacccgaaggtcgccgcggccgtcgccgcgcaggccgcg
cagttcacgcacacctgcttcatgatctcgccgtacgagtcgtacgtcggcgtcgccgag
gcgctcaaccgcgtcacccccggagacttcgccaagaagagcgccctgttcaactccggc
gccgaggccgtcgagaacgcgatcaagatcgcccgcaagcacaccggacgccaggccgtc
gtcgcgttcgaccacggctaccacggccggacgaacctcaccatggcgctgaccgcgaag
tcgatgccctacaagagcggcttcggcccgttcgcccccgaggtctaccgcgcgccgatg
tcctacccgttccgcgacggactcgagggcggcgaggccgcggcccgcgtgatcctccag
ctcgagaagcagatcggcgcggacaacctcgcggccgtcatcatcgagcccatccagggc
gagggcggcttcatcgtccccgccgacggcttcctccccgcgatcgtcgactggtgccgc
gcgaacggcgtcgtcttcatcgccgacgaggtgcagaccggcttcgcccgcaccgggcac
atgttcgccagcgagatcttcggcatcgagcccgacctcatcaccaccgccaagggcatc
gcgggcgggctgcccctcgcggccgtgaccggtcgcgccgagatcatggacgcctcgcac
tccggcggcctcggcggcacctacggcggcaacccgatcgcctgtgccgcggcgctggct
gcgatcgacgtgttcgagaacgacggcgtcatcgagcgggcccgcgagatcggcgagatc
ctcatcggccgcctcaccgctctccaggccgaggacgcccgcatcggcgacgtccgcggt
cacggcgcgatggtcgcggccgagttcgtggacccggagaccaaggctccggacgccgcg
ctcacggccgccgtggccaaggcgtgcatcgctcagggcgtcatcgtcctcacctgcggc
acgtacggcaacgtcatccgcttcctcccgccactgtccatcggcgacgagctgctgaac
gagggcctcgacgtcgtggccgaggcgctcgccggcgcctga

DBGET integrated database retrieval system