KEGG   Microbacterium sp. PAMC 28756: AXH82_04650Help
Entry
AXH82_04650       CDS       T04312                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mip  Microbacterium sp. PAMC 28756
Pathway
mip00250  Alanine, aspartate and glutamate metabolism
mip00410  beta-Alanine metabolism
mip00430  Taurine and hypotaurine metabolism
mip00650  Butanoate metabolism
mip01100  Metabolic pathways
mip01110  Biosynthesis of secondary metabolites
mip01120  Microbial metabolism in diverse environments
mip02024  Quorum sensing
Module
mip_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AXH82_04650
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AXH82_04650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXH82_04650
   00430 Taurine and hypotaurine metabolism
    AXH82_04650
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AXH82_04650
Enzymes [BR:mip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AXH82_04650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DotU
Motif
Other DBs
NCBI-ProteinID: AMG82755
LinkDB All DBs
Position
complement(941703..943073)
Genome map
AA seq 456 aa AA seqDB search
MSISSADDQPLFTRPGEATVAPRHVIPDSESLPATAKQIVEDETILDGNARLNLATFVST
WMDDEAKQVYMASFDKNMIDKDEYPQTAAIEDNCWHMLANLWKAPDASRSIGTSTIGSSE
ACMLGGLAFKRRWQQARRAAGKDASTPNLVMSSAVQVCWEKFCNYFDVEPRYVPISEEHK
TLDGHDLEKYVDENTIGVVAIMGVTYTGMYEPVAEIAAALDAIQEKTGLDIPIHVDGASG
AMIAPFLQPDLVWDFRLERVHSISTSGHKYGLVYPGLGWVVWRDAHWLPEDLVFKVSYLG
GEMPTFALNFSRPGAQVLLQYYLFLRLGFEGYRAVQQASQDVAKFLSAGIAKLDAFELWN
DGSDIPVFAWRLKDGHTDKWTLYHLQDRLRMRGWLVPAYPMPADLEDLTVQRIVVRNGLS
MDLAAELLDAITAEVAHLDALTAPMPSDHPDSAFHH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctcctccgccgacgaccagccgctcttcacgcggccgggtgaggccaccgtc
gcaccgcgacacgtcatcccggattccgagtcgcttcccgcgacggcgaagcagatcgtc
gaggacgagaccatcctcgacggcaacgcgcgcctcaacctcgccaccttcgtcagcacc
tggatggatgacgaggcgaagcaggtctacatggcctccttcgacaagaacatgatcgac
aaggacgagtatccgcagaccgccgccatcgaggacaactgctggcacatgctcgcgaac
ctgtggaaggcgccggacgcctcccgcagcatcggcacgtcgaccatcggctcctccgag
gcgtgcatgctcggcggtctcgcgttcaagcgtcgctggcagcaggcccgccgtgccgcc
ggcaaggacgcctccacgccgaacctcgtgatgtcgagcgcggtgcaggtgtgctgggag
aagttctgcaactacttcgatgtggaaccgcgctacgtgcccatcagcgaggagcacaag
acgctcgacggccatgacctcgagaagtacgtggacgagaacacgatcggggtggtcgcc
atcatgggcgtcacctacaccggcatgtacgagccggtggccgagatcgctgcggcgctc
gacgcgatccaggagaagacgggtctcgacatcccgatccacgtggacggcgcctcgggc
gcgatgatcgccccgttcctccagcccgacctggtctgggacttccggctggagcgcgtg
cattccatcagcacctcgggacacaagtacggtctcgtctacccgggtctcgggtgggtg
gtctggcgcgacgcgcactggctgccggaggacctggtgttcaaggtgagctatctcggc
ggggagatgccgaccttcgccctgaacttctcccgccctggcgctcaggtgctgctgcag
tactacctgttcctccgcctcgggttcgagggctaccgggccgtgcagcaggcctcgcag
gacgtggcgaagttcctctccgcgggcatcgcgaagctcgatgcgttcgagctgtggaac
gacggcagcgacatccccgtcttcgcctggcgcctgaaggacgggcacaccgacaagtgg
acgctctaccacctccaggaccgcctccggatgcgcggctggctcgtgcccgcctatccg
atgcccgcggacctcgaagacctcacggtgcagcggatcgtcgtgcgcaacgggctcagc
atggacctggccgccgaactgctcgacgccatcaccgccgaggtggcccacctcgacgcg
ctcacggctcccatgccgtccgaccaccccgactcggcgttccaccactag

DBGET integrated database retrieval system