KEGG   Microbacterium sp. PAMC 28756: AXH82_06850Help
Entry
AXH82_06850       CDS       T04312                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mip  Microbacterium sp. PAMC 28756
Pathway
mip00630  Glyoxylate and dicarboxylate metabolism
mip01100  Metabolic pathways
mip01120  Microbial metabolism in diverse environments
mip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mip00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AXH82_06850
Enzymes [BR:mip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AXH82_06850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AMG83121
LinkDB All DBs
Position
1410087..1411337
Genome map
AA seq 416 aa AA seqDB search
MSTDRIHAHYVIETGGSLESAAAAMAGEQSTGTFVALPGETPELHARHAATVERITPLDD
AVVPSLSGAVASADSRYRRAEVELSFPLENVGTALPNLLATVAGNLFELQQLSGIRLEAL
DLPPAFGAAHPGPQFGIEGTRRLAGVQDRPIIGTIIKPSVGLTPDETAALAGDLARAGLD
FIKDDELMANSPHSPFDERLSAVMHSLQDAADDTGALAMYAVNVTDELDEMLRHVDAVAE
AGGTCVMVSVNAVGLGALRAVRERSSLPIHAHRNGWGAMTRHPLLGYSYAVWSQLWRLAG
ADQLHVNGLRNKFWEPDASVLRSARACLRPENGHPAVMPVFSSAQSADQAADTYAALGTV
DLMYVCGGGIMAHPDGPAAGATSIRQAWRAAVDGVPASEYAQTHAELAAALSLFAR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaccgcatccacgcccactacgtcatcgagaccggtggcagcctcgaaagc
gccgctgcagcgatggcgggggagcagtccacggggacgttcgtcgcgttgccgggcgag
acccccgagctgcacgcgcgtcacgcggcgaccgtcgagcgcatcacgccgctcgacgac
gccgtcgttccatcgctgagcggtgccgtcgcatctgccgacagccgctatcgtcgcgcc
gaggtggaactgtccttcccgctggagaacgtggggacggcgctgccgaacctgctggcg
acggtcgccgggaatctcttcgagctgcagcagctcagcggcatccgtctggaggcgctg
gacctcccgcccgcgttcggggcggcgcacccgggccctcagttcggcatcgagggaacc
cgccggctcgccggcgttcaggaccgccccatcatcggcaccatcatcaagcccagcgtg
ggactcacccccgatgagaccgcagccctggccggtgacctcgcccgcgccggactcgac
ttcatcaaggacgacgagctcatggcgaactcgccgcactcgccattcgacgagcggctc
agcgcggtcatgcacagcctgcaggatgcggccgacgacaccggtgctctggccatgtac
gcggtgaacgtcaccgacgagctcgacgagatgctgcggcatgtcgacgccgtcgccgag
gccggcggcacctgcgtgatggtcagcgtgaacgccgtcggtctcggggcgctgcgggcg
gttcgcgagcgcagctcacttccgatccacgcgcaccgcaacggatggggcgcgatgact
cggcacccgctcctcggctactcgtatgccgtgtggtcgcagctgtggcgactggcgggc
gccgaccaactgcacgtgaacggcctgcgcaacaagttctgggagccggacgcctcggtg
ctgcgctcggcgcgggcctgcctgcggcccgagaacggacacccggcggtgatgccggtg
ttctcgtcggcgcagtccgccgaccaggccgccgacacgtatgccgcactcggaacggtc
gacctgatgtacgtgtgcggcgggggcatcatggcccatcccgacgggcccgctgcgggc
gcgacgagcatccggcaggcgtggcgggccgccgtcgacggcgtacccgcgtccgagtac
gcgcagacgcacgcggagctcgcggccgcactgagtctcttcgcgcgctga

DBGET integrated database retrieval system