KEGG   Microbacterium sp. PAMC 28756: AXH82_07345Help
Entry
AXH82_07345       CDS       T04312                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mip  Microbacterium sp. PAMC 28756
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase PNKP_ligase DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMG85044
LinkDB All DBs
Position
1509095..1510081
Genome map
AA seq 328 aa AA seqDB search
MPAGLRPPLGVALARPVETVPAADALPGGARYEPKWDGFRLLLVVDDDITLWSRQGKNLT
RAFPELVAAAAQLPNGVILDGEAVVWSDDRLDFDALLRRTNGSSSTVAKLSRAQPASYVA
FDILAIADRDARDLRLDDRRTLLEELAREWSPPLNLSPVTADAAEAARWFRALVASGIEG
LVVKGGAQPYVGGDRTWVKVKHHDTLDVICAAVIGSRERPEELVVGLPIDGELRIVGRSA
RLAANTARKLGRLLQEPAASHPWPQEVKPGALSRFNRSGREPVRLTLVQPLVVEISADVA
MAGQSFRHVVRFVRARPEIPVAEVEPSR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ctgccggccgggctgcgtccgccgctaggcgtggcgttggcccggccggtggaaacggtc
ccggccgcggatgcgctgcccggcggggcgaggtatgaaccgaagtgggatggatttcgg
ctgctgctcgtggtcgacgacgacatcactttgtggtcgagacagggtaagaacctcacc
cgcgcctttcccgaactggtagcggcggccgcgcagcttcccaacggtgtcatcctcgat
ggtgaggccgtggtgtggtcggacgaccgcctggacttcgatgcgctgctgcgccgcacg
aacggcagctccagcaccgtcgcaaagctctcccgcgcacagccggcatcgtatgtggcc
ttcgacattctcgcgatcgcggatcgtgacgcacgcgatctacgcctggacgatcggcgc
acgttgctcgaagagttggcgcgggagtggtctccgccgctgaacctctctcctgtcacc
gcggatgctgcggaagccgcacggtggttccgtgcgctcgtggcgtcggggattgaaggg
ctcgtcgtcaagggcggggcacagccctacgtcggcggcgatcgaacgtgggtgaaggtg
aaacaccatgacacgctggacgtcatctgtgccgccgtgatcggatcgcgcgagcgtccc
gaagaactcgtggtcgggctgccgatagacggcgagctgcggatcgtgggccgctcggca
cgcctggcggcgaacacggcgcggaaactgggccgactgctgcaggagcctgcggcatct
cacccgtggccgcaggaggtgaagccgggagccctgagccgtttcaaccgatcaggacga
gagccggtacgactgacgctcgtgcagccgctggtcgtcgagatctcagcggacgtggcg
atggcgggccagtccttccgccatgtcgtgcggttcgtccgcgcccggccggagatcccc
gtcgcggaggtcgagccctcccgctga

DBGET integrated database retrieval system