KEGG   Microcystis sp. MC19: B5D77_06235Help
Entry
B5D77_06235       CDS       T05365                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
miq  Microcystis sp. MC19
Pathway
miq00473  D-Alanine metabolism
miq00550  Peptidoglycan biosynthesis
miq01100  Metabolic pathways
miq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:miq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B5D77_06235
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B5D77_06235
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    B5D77_06235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:miq01011]
    B5D77_06235
Enzymes [BR:miq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B5D77_06235
Peptidoglycan biosynthesis and degradation proteins [BR:miq01011]
 Precursor biosynthesis
  Amino acid ligase
   B5D77_06235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AVQ70977
UniProt: A0A2P1UDI8
LinkDB All DBs
Position
1220828..1221886
Genome map
AA seq 352 aa AA seqDB search
MDKIKVGLLFGGRSGEHEVSINSARSILQAFNYPENLDKYAVIPFYIDKNGCWHSAATAR
QILTSGQPLAIESDIKVNIWQFPPEVSEIEVWFPILHGPNGEDGTLQGLLTLMRVAFVGS
GVLGSCLGMDKIAMKTAFAAAGLPQVKYKAITRSQVWSNACVFPQLCDQIAEEIGYPCFI
KPANLGSSVGISKARNRQELEAALDSAASYDRRIIVEAGVTAREIECAVLGNDNPQASLV
GEITFDSDFYDYETKYTDGRSSMVIPANIPDKIANQVREMAVEAFKAVDAAGLSRVDFFY
VEKTGEVLLNEINTLPGFTNFSMYPQLWKATGLEFDKLVDKLVQLALEKQEK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggataagatcaaggtaggattgttgtttggtggtcgatcgggagaacacgaggtatct
atcaattcggctcgatcgatcctgcaagcttttaattatcccgaaaatcttgacaaatac
gccgttatccccttctatatcgataaaaatggctgttggcattcggcagcaactgctaga
caaattttaacctctgggcaacccctagctattgagagtgatataaaagtcaatatctgg
caatttcctccagaagtgagcgaaattgaggtttggtttccaattctccacggaccgaat
ggagaagatggaactttgcaaggattactcactctcatgcgggttgcttttgtgggtagt
ggggttctgggttcatgcctaggcatggataaaattgccatgaaaactgcttttgcagcc
gctggattaccccaagttaagtataaggccataacccgctcgcaagtgtggtcaaatgcc
tgtgtttttccgcaattgtgcgatcaaatcgccgaggaaataggttatccttgttttatt
aaaccggctaatttaggttcttcggtgggtattagtaaagcacgcaaccggcaagaatta
gaggctgctttagatagcgctgctagttatgatcgacggattattgttgaagcaggagta
accgcaagggaaatcgaatgtgcagttttaggtaatgataatccccaagcttctttggtg
ggagaaattacttttgatagtgatttttatgactatgaaactaaatatactgatgggcga
tcaagtatggtgattcccgctaatattcctgataaaattgctaatcaagtgcgagaaatg
gctgtagaagcatttaaagctgtggatgctgcgggattgtcgcgggtggattttttctat
gtggagaagactggggaagtgttgctcaatgaaattaatactctgccggggtttactaat
tttagtatgtatccccaactctggaaagccactggtttagagtttgataaattggtcgat
aagttggtacaattagctttagaaaaacaggaaaaataa

DBGET integrated database retrieval system