KEGG   Microcystis sp. MC19: B5D77_16895Help
Entry
B5D77_16895       CDS       T05365                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
miq  Microcystis sp. MC19
Brite
KEGG Orthology (KO) [BR:miq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:miq01001]
    B5D77_16895
Enzymes [BR:miq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     B5D77_16895
Protein kinases [BR:miq01001]
 Serine/threonine kinases: Other
  Bacterial family
   B5D77_16895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Knl1_RWD_C
Motif
Other DBs
NCBI-ProteinID: AVQ72763
UniProt: A0A2P1UIL2
LinkDB All DBs
Position
complement(3359058..3360635)
Genome map
AA seq 525 aa AA seqDB search
MLDQMMKMLEGQQIGPYRLNKFLGAGGFGGVFHASEMVRNTSVKEVAIKVIPESSDDKLI
ELTNSRKLEHPNLIKSYAVGEFTFLKTEMLYLVMELAQGSLENHIAKGSLSADEITNITA
QVAQGLNYLHRQNKVHRDLKPGNILKVNQQYKLADFGLIRTLNNKSHTQTVHNTGTIIYM
PPEAFRGDISSAWDLWSLGIMLIQMTTNQFPYKFNNDNNQLMVKVINCELQIPSLPKEFK
PIIEGCLQKDRRQRWTAQQVLNALQALKKPVSPIPLIASPTPFTENLPNRVTLEMVSLPA
GEFLMGSPDSDPNALDDEKPQHQVKVNSFAIGKYPVTQAQYQAVMGTNPSRFKNWFKNNP
QNPVENVNWNDAQAFCQKLSQITGKSYRLPTEAEWEYACRAGTTTRFYFGDDANQLGDYA
WYDGNSQKTTHPVGQKRPNAWGLYDMSGNVWEWCEDDWHSSYIGAPTDGSAWLINDNDND
YRIRRGGSWCLNPNVCRSACRNVSRRRDSHLSFGFRVVCGAGRTL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctagaccaaatgatgaagatgttagaagggcaacaaataggcccctatcgtcttaat
aaatttctcggtgcgggtggttttgggggtgtatttcatgctagtgaaatggtcagaaat
acatcggtcaaagaagttgccattaaagttatccccgaaagtagcgatgataaattaatt
gagttaacaaattccagaaagttagaacatcctaatttaattaagagttatgcggtgggg
gaatttacttttctcaagacagagatgctttatttagtgatggaattggcacagggtagc
ctagaaaatcacattgccaaaggcagtttgtcagcggatgagattacaaatattactgct
caagtcgctcagggcttaaattatcttcatcgacaaaataaagtgcatcgagatttaaaa
ccgggtaatatcctcaaggttaatcaacaatacaagttagcagattttggcttaattaga
accttaaataacaaaagccacactcaaacagtccacaataccggtacaattatttatatg
cctcccgaagcctttaggggtgatatttcctcagcttgggatctgtggtcattaggtatt
atgttaatccaaatgacgactaatcaatttccctataagttcaataatgacaataatcaa
ttaatggtaaaggtgataaattgtgagctacaaatccctagtttaccgaaagagtttaaa
ccgattattgaagggtgtttgcaaaaagatagaagacaaagatggactgcacaacaggtt
ttaaatgccttacaagcactcaaaaagcctgtttcaccaatacccctaattgcttcaccc
actccatttaccgaaaacctacccaatcgagtcacactagagatggtgagcttaccagca
ggtgagtttctcatgggatctcctgacagtgatcccaatgctttggatgatgaaaagcct
caacaccaagttaaagtcaacagttttgcgattggtaaatatcctgtgactcaggcacaa
tatcaagcagtaatgggaaccaatccctctcggtttaaaaattggtttaaaaataatccc
caaaatccagtagaaaatgttaactggaacgatgctcaagccttttgtcagaaattgagt
caaataaccggcaaaagctatcgcctccccacagaagcggaatgggaatatgcttgtcgt
gcggggactactactcgcttttatttcggtgatgatgctaatcagttaggagattacgct
tggtatgacggaaattctcagaagacaactcatcctgtgggccagaaaaggcccaatgct
tggggactctatgacatgagtggcaatgtttgggaatggtgcgaagacgattggcatagt
agctatatcggagcgccgacggatggcagtgcttggttaataaatgataatgataatgat
tatcgcatacggcggggcggttcttggtgcctcaatccaaatgtctgccgttccgcttgc
cgcaacgtcagccgccgccgcgacagccacctcagcttcggttttcgggtggtgtgcggt
gctgggaggactctgtaa

DBGET integrated database retrieval system