KEGG   Microcystis sp. MC19: B5D77_22000Help
Entry
B5D77_22000       CDS       T05365                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
miq  Microcystis sp. MC19
Brite
Enzymes [BR:miq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B5D77_22000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AVQ74421
UniProt: A0A2P1UNC4
LinkDB All DBs
Position
4381469..4382068
Genome map
AA seq 199 aa AA seqDB search
MAYTLPALPYDYTALEPCITKSTLEFHHDKHHAAYVNNYNGLVKDTELDALSLEEVIVKV
AGDASKAGVFNNAAQSWNHSFYWNCMKPGGGGAPTGALAAKINADFGSFEKFVEAFKTAG
ATQFGSGWAWLVLDKGTLKVTKTGNADNPLTAGQVPLLTMDVWEHAYYLDYQNRRPDYIS
DFLTKLVNWDFVAANLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacacttcccgctttaccctacgattacactgccttagagccttgcatcacc
aaaagtaccctagaattccaccacgacaagcaccacgccgcttatgtcaataactataac
ggtttggtcaaagatacggaactcgatgctctctctttagaagaagttatcgttaaggtg
gccggtgatgcctctaaagctggggttttcaacaatgccgcccaatcatggaaccatagt
ttttattggaactgcatgaaaccgggtggtggcggtgcgcctactggtgctttagccgct
aaaattaacgcagatttcggcagtttcgagaaatttgtcgaagctttcaaaactgcgggt
gctactcaattcggtagcggttgggcttggttagttctcgataagggtactctcaaagtt
accaaaaccggcaacgctgacaatcctttaaccgccggacaggttcccctcctaactatg
gatgtgtgggaacacgcttattatctcgactaccaaaatcgtcgtcccgattacatcagc
gactttttaactaagttggttaattgggatttcgtggctgctaatttagcggcggcctaa

DBGET integrated database retrieval system