KEGG   Microcystis sp. MC19: B5D77_23595Help
Entry
B5D77_23595       CDS       T05365                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
miq  Microcystis sp. MC19
Pathway
miq00010  Glycolysis / Gluconeogenesis
miq00020  Citrate cycle (TCA cycle)
miq00620  Pyruvate metabolism
miq01100  Metabolic pathways
miq01110  Biosynthesis of secondary metabolites
miq01120  Microbial metabolism in diverse environments
miq01130  Biosynthesis of antibiotics
miq01200  Carbon metabolism
Module
miq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:miq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5D77_23595
   00020 Citrate cycle (TCA cycle)
    B5D77_23595
   00620 Pyruvate metabolism
    B5D77_23595
Enzymes [BR:miq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B5D77_23595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p DUF4781
Motif
Other DBs
NCBI-ProteinID: AVQ73870
UniProt: A0A2P1ULR1
LinkDB All DBs
Position
4680852..4682111
Genome map
AA seq 419 aa AA seqDB search
MIRDIFMPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVIL
VEAGQEAPVGEAIAYIAETEEEIELAKAQGKTAATAPSKPVETPEIAPPPVSIPVAAVKD
NGRLVASPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVS
VPVAAPKAPIPTSAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQL
KSKGVTMTALLAKAVANTLAKHPIVNACYSDAGIQYHGAINVAVAVAMPDGGLITPVLRS
ANQMDIYSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAIL
AVGASRPQIVVHNNGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagatatcttcatgcccgcgctcagttccaccatgaccgaaggaaaaatagtt
tcttgggtgaagtcccccggggaaaaagtcagcaaaggggaaacggtgttagtggtcgaa
tccgacaaagccgacatggacgtagaatcgttttatgatggctatctcgctgtaatttta
gtcgaagctggccaggaagcacccgtgggggaagcgatcgcctatattgccgaaactgaa
gaggaaattgaactggccaaagctcagggaaaaaccgccgcaaccgcccctagcaagcct
gtagagaccccagaaatcgctccgcctcccgtttcgatccccgtcgccgccgttaaagat
aatggccgtttagtcgcctctcccagggccaaaaaactggctaaagaattaaaggtagat
ctgaaaaccctagtgggtagcggtccccacggacgaattaccgccgaagacgtagaaaaa
gcgacaggaaaagtcagcaccgcccccgctcccgtcattactcccccgcaacccgtcagt
gtgcctgtagcggctcctaaagccccgattccaaccagcgccccggtcggtcggactgtt
cccctcaccactctgcaaaaagccgtcgcccagaatatgtcggttagcctacaggttccc
accttccaagtgggctacactatcaccaccgacccactggatcaactctatcaacagcta
aaatccaagggtgtcaccatgacggccctgttagcaaaagcggtggccaacaccctcgct
aaacatcctatagttaatgcctgctatagcgacgcaggaattcaataccacggggcgatt
aacgtcgctgtcgccgtagctatgcccgatggtggcttaattacgccggttttgcgctct
gctaaccagatggatatctattccctctcccgcagttggaaagatttagttgatcgcgcc
cgcagtaaacaactgcaaccggaagaatataatagcggtacttttaccatttctaatctg
ggaatgttcggagtcgatcgctttaccgctatcttaccccccaaccaaggcgcaatcctg
gcagtgggtgcttcccgtccccaaatcgtcgtccacaataatggtttattcggagtgcaa
aaacagatgacggttaatctcaccagtgaccaccgagtcatctacggggccgatgcggcc
tccttcctgcaagacttggctaaactgatcgaaaccgaggtacagtctttaactatgtaa

DBGET integrated database retrieval system