KEGG   Microcystis sp. MC19: B5D77_23595
Entry
B5D77_23595       CDS       T05365                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
miq  Microcystis sp. MC19
Pathway
miq00010  Glycolysis / Gluconeogenesis
miq00020  Citrate cycle (TCA cycle)
miq00620  Pyruvate metabolism
miq01100  Metabolic pathways
miq01110  Biosynthesis of secondary metabolites
miq01120  Microbial metabolism in diverse environments
miq01200  Carbon metabolism
Module
miq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:miq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5D77_23595
   00020 Citrate cycle (TCA cycle)
    B5D77_23595
   00620 Pyruvate metabolism
    B5D77_23595
Enzymes [BR:miq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B5D77_23595
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p DUF4781 Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: AVQ73870
UniProt: A0A2P1ULR1
LinkDB
Position
4680852..4682111
AA seq 419 aa
MIRDIFMPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVIL
VEAGQEAPVGEAIAYIAETEEEIELAKAQGKTAATAPSKPVETPEIAPPPVSIPVAAVKD
NGRLVASPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVS
VPVAAPKAPIPTSAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQL
KSKGVTMTALLAKAVANTLAKHPIVNACYSDAGIQYHGAINVAVAVAMPDGGLITPVLRS
ANQMDIYSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAIL
AVGASRPQIVVHNNGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgattcgagatatcttcatgcccgcgctcagttccaccatgaccgaaggaaaaatagtt
tcttgggtgaagtcccccggggaaaaagtcagcaaaggggaaacggtgttagtggtcgaa
tccgacaaagccgacatggacgtagaatcgttttatgatggctatctcgctgtaatttta
gtcgaagctggccaggaagcacccgtgggggaagcgatcgcctatattgccgaaactgaa
gaggaaattgaactggccaaagctcagggaaaaaccgccgcaaccgcccctagcaagcct
gtagagaccccagaaatcgctccgcctcccgtttcgatccccgtcgccgccgttaaagat
aatggccgtttagtcgcctctcccagggccaaaaaactggctaaagaattaaaggtagat
ctgaaaaccctagtgggtagcggtccccacggacgaattaccgccgaagacgtagaaaaa
gcgacaggaaaagtcagcaccgcccccgctcccgtcattactcccccgcaacccgtcagt
gtgcctgtagcggctcctaaagccccgattccaaccagcgccccggtcggtcggactgtt
cccctcaccactctgcaaaaagccgtcgcccagaatatgtcggttagcctacaggttccc
accttccaagtgggctacactatcaccaccgacccactggatcaactctatcaacagcta
aaatccaagggtgtcaccatgacggccctgttagcaaaagcggtggccaacaccctcgct
aaacatcctatagttaatgcctgctatagcgacgcaggaattcaataccacggggcgatt
aacgtcgctgtcgccgtagctatgcccgatggtggcttaattacgccggttttgcgctct
gctaaccagatggatatctattccctctcccgcagttggaaagatttagttgatcgcgcc
cgcagtaaacaactgcaaccggaagaatataatagcggtacttttaccatttctaatctg
ggaatgttcggagtcgatcgctttaccgctatcttaccccccaaccaaggcgcaatcctg
gcagtgggtgcttcccgtccccaaatcgtcgtccacaataatggtttattcggagtgcaa
aaacagatgacggttaatctcaccagtgaccaccgagtcatctacggggccgatgcggcc
tccttcctgcaagacttggctaaactgatcgaaaccgaggtacagtctttaactatgtaa

DBGET integrated database retrieval system