KEGG   Mycobacterium paraintracellulare: OCQ_01870Help
Entry
OCQ_01870         CDS       T01755                                 

Definition
(GenBank) [Mn]-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mir  Mycobacterium paraintracellulare
Brite
Enzymes [BR:mir01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     OCQ_01870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFC51700
UniProt: A0A1X2KII0
LinkDB All DBs
Position
complement(186086..186709)
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYAALEPHISGQINEIHHSKHHATYVKGVNDALSKLEEARANEDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPDGGDKPTGELAAAIDDAFGSFDRFRAQFSAAANGL
QGSGWAVLGYDTLGNRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQKRYAAATSKTQGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgcccgacttggactgggactacgcagcgttggaaccgcacatc
tcaggtcagatcaacgagatccaccacagtaagcaccacgccacctacgtcaaaggcgtg
aacgacgctctgtccaagctcgaagaggcccgtgccaacgaagatcacgctgcgatcttc
ctgaacgaaaagaacctggcctttcacctgggcggccacgtcaaccactccatctggtgg
aagaacctgtcgccggacggcggcgacaagccgaccggcgaattggccgccgcgatcgac
gacgccttcggatccttcgaccggttccgcgcgcagttcagcgcggccgccaacggcctg
caggggtcgggctgggcggtgctgggctacgacaccctcggcaaccggctgctgaccttc
cagctctacgaccagcaggccaacgtgccgctgggcatcattccgctgctgcaggtcgac
atgtgggagcacgctttctacctgcagtacaagaacgtcaaggcggactacgtcaaggcg
ttctggaacgtcgtcaactgggccgacgtgcagaagcgttacgccgcggcgacctcgaaa
acccagggcctgattttcggctga

DBGET integrated database retrieval system