KEGG   Mycobacterium paraintracellulare: OCQ_03200Help
Entry
OCQ_03200         CDS       T01755                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mir  Mycobacterium paraintracellulare
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFC51833
LinkDB All DBs
Position
complement(327102..328157)
Genome map
AA seq 351 aa AA seqDB search
MPPVSPMLAKSVRAIPPHASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPELVAAV
RAELPERCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEATPASFIAFDLLALGGD
DYTRRPFSERRAALVDAVGGSGRSIHVTPATTDLGTAQRWFDEFEGAGLDGVIAKPLDVT
YQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIGAFPMA
ERRRLFAELQPLVTDFADHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVPLRPERVVEV
RYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFSLGEIVPGLGPG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgtcgccgatgctggccaagtcggttcgcgctatcccgccccacgcgtcg
tacgagcccaagtgggacggattcaggtcgatctgtttccgcgacggcgacgacgtcgag
ctgggcagccgcaacgagcggccgatgacccgctactttccggagttggtcgccgcggtc
agggccgagctgccggagcgctgcgtgatcgacggggagatcgtcatcgccaccgaccac
ggcctggacttcgaggcgctgcagcaacgcattcacccggccgactcgcgggtgcggatg
ctcgccgaggcgacgcccgcgtccttcatcgcgttcgacctgctggcgctcggcggcgac
gactacacccggcggccgttcagcgagcggcgggcggccctggtcgatgcggtgggcgga
tcgggtcgctcgatccatgtcacgcccgcgacgaccgatctgggcaccgcgcagcgatgg
ttcgacgagttcgagggcgccggcctcgatggcgtgatcgccaagcccctggacgtcacc
taccagccggacaagcgggtgatgttcaagatcaagcacgaacggaccgcggactgtgtg
gtcgccggctatcgggtccacaagtccggcgccgacgcgatcgggtcgctgctgctgggg
ctctaccaggacgacgggcagctggcctcggtcggcgtcatcggcgcgttcccgatggcc
gagcggcgccggctgttcgccgaactgcagccgctcgtcaccgacttcgcggaccatccg
tggaactgggccgcccacgaggccggcgagcggacgccccgcaagaacgaatactcgcga
tggaacgccggcaaggacctctcgttcgtgccgctgcggcccgagcgcgtggtcgaggtc
cgctacgaccacatggagggtcggcggtttcgccataccgcgcagttcaatcggtggcgt
ccggaccgcgacccgcgctcgtgcacctacgaacagctggaacagccggtgacgttcagc
ctcggcgagatcgtgccgggcctcggcccgggctga

DBGET integrated database retrieval system