KEGG   Mycobacterium paraintracellulare: OCQ_08620Help
Entry
OCQ_08620         CDS       T01755                                 

Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00071  Fatty acid degradation
mir00280  Valine, leucine and isoleucine degradation
mir00281  Geraniol degradation
mir00310  Lysine degradation
mir00362  Benzoate degradation
mir00380  Tryptophan metabolism
mir00410  beta-Alanine metabolism
mir00640  Propanoate metabolism
mir00650  Butanoate metabolism
mir00903  Limonene and pinene degradation
mir00930  Caprolactam degradation
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
mir01130  Biosynthesis of antibiotics
mir01200  Carbon metabolism
mir01212  Fatty acid metabolism
Module
mir_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    OCQ_08620
   00650 Butanoate metabolism
    OCQ_08620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCQ_08620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCQ_08620
   00310 Lysine degradation
    OCQ_08620
   00380 Tryptophan metabolism
    OCQ_08620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCQ_08620
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCQ_08620
   00281 Geraniol degradation
    OCQ_08620
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCQ_08620
   00930 Caprolactam degradation
    OCQ_08620
Enzymes [BR:mir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     OCQ_08620
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCQ_08620
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     OCQ_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C F420_oxidored UDPG_MGDP_dh_N NAD_binding_8 Pox_F12L
Motif
Other DBs
NCBI-ProteinID: AFC52375
UniProt: A0A1X2KLH5
LinkDB All DBs
Position
850206..852350
Genome map
AA seq 714 aa AA seqDB search
MAENTIAWDEDADGIVTLTLDDPTGSANVMNEHYSESMHNAVERLAAEKDSITGVVITSA
KKTFFAGGDLKGMINLGPENAGEAFDTVESVKRDLRALETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSVLGLPEVTLGLLPGGGGVTRTVRMFGIQKAFMEVLSQGTRFKPAK
AKEIGLVDELVGSVDELVPAAKAWIKANPDSHEQPWDKKGYKMPGGTPSSPALAGILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTASRIESRYFTQLVTGQVAKNMIQAFFF
DLQHINGGGSRPDGIEPVKINKIGVLGAGMMGAGIAYVSAKAGFDVVLKDVDIEAAQKGK
GYSEKLEAKALQRGKTTEEKSKALLDRITPTADPAELAGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEHAGSQAGYP
APPLQLSDELNLELMHKIAAATRKGVEDAGGTYEPHPAEAVVDKMIEIGRPSRLKGAGFY
EYVDGKRTRLWPGLQETFKSGSAEIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANIG
SIMGIGFPPYTGGSAQFIVGYSGAGGTGKDAFVARAKELAAKYGERFLPPKSLS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaccattgcgtgggatgaggacgccgacggcatcgtcaccctgacgctt
gacgaccccaccgggtcggccaacgtgatgaacgagcactacagcgagtccatgcacaac
gctgtggaacgccttgccgccgagaaggattcgatcaccggcgtggtgatcaccagcgcg
aagaagaccttcttcgccggtggtgacctgaagggcatgatcaacctcggccccgagaac
gccggcgaggcgttcgacaccgtcgagtcggtcaagcgcgacctgcgtgcgctggagacc
ctgggcaagccggtggtggccgccatcaacggcgccgcactgggcggcggcctggagatc
gcgctggcctgccaccaccggatcgccgccgacgtcaagggcagcgtcctcggtctgccc
gaggtgacgctgggcctgctgccgggcggcggcggggtgacccgcaccgtgcggatgttc
ggcatccagaaggcattcatggaggtgttgagccagggcacccgcttcaagccggccaag
gccaaggagatcggcctggtcgacgagctcgtcggctcggtcgacgaactggtgcccgcc
gccaaggcgtggatcaaggccaaccccgattcgcacgaacagccctgggacaaaaagggt
tacaagatgcccggcggcaccccgtccagccccgcgctggccggcatcctgccgtcgttc
ccggcgctgctcaagaagcaactcaagggcgccccgatgccggcgccgcgggccatcctg
gacgcggccgtcgagggcgcgcaggtggacttcgacacggccagccgcatcgaaagccgt
tacttcacccagctggtcaccggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctgcagcacatcaacggcggcggttcgcgccccgacggcatcgagccggtcaagatc
aacaagatcggtgtgctgggcgcgggcatgatgggcgccggcatcgcctacgtgtcggcc
aaggccggcttcgacgtggtgctcaaggacgtcgacatcgaggccgcccagaagggcaag
ggttactcggaaaagcttgaggccaaggcacttcagcgtggcaagaccaccgaggagaag
agcaaggcgctgctggaccgcatcacgccgactgccgaccccgccgagctggcgggcgtc
gacttcgtgatcgaggcggtgttcgagaaccaggaactcaagcacaaggtgttccaggag
atcgaggacatcgtcgaacccaacgcgctgctcgggtcgaacacctcaaccctgccgatc
accggtctggcgaccggcgtcaagcggcaggaggacttcatcggaatccacttcttctcg
ccggtcgacaagatgccgctggtggaaatcatcaagggcgagaagacttccgacgaggcc
ctggcccgggtgttcgactacacgctggcgatcggcaagacgccgatcgtggtcaacgac
agccgcgggtttttcaccagccgcgtgatcggcacgttcgtgaacgaggcgctggcgatg
ctcggcgagggcgtggccccggccagcatcgagcacgccggttcgcaggccggctacccg
gcgccgccgctgcagctgtccgacgagctcaacctggagctgatgcacaagatcgccgcg
gccacccgcaagggcgtcgaggacgcgggcggcacctacgagccgcacccggccgaggcc
gtcgtcgacaagatgatcgaaatcggacggcccagccgcttgaagggcgccggcttctac
gagtacgtggacggcaagcggacccgcctgtggcccggcctgcaggagacgttcaagtcg
ggcagcgcggagattccgttgcaggacatgatcgatcgcatgctgttcgccgaggcgctc
gagacgcagaagtgtctggacgagggcgtgctgacctcgaccgccgacgccaacatcggc
tcgatcatgggcatcggcttcccgccgtacaccggtggtagcgcacagttcatcgtcggt
tactccggtgccggcggcacgggcaaggatgcgttcgtggcccgcgccaaggaactggcg
gccaagtacggcgagcggttcctgccgccgaagtcactgagttaa

DBGET integrated database retrieval system