KEGG   Mycobacterium paraintracellulare: OCQ_17550Help
Entry
OCQ_17550         CDS       T01755                                 

Definition
(GenBank) hypothetical protein
Organism
mir  Mycobacterium paraintracellulare
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 NAD_binding_7 ThiF UDPG_MGDP_dh_N TrkA_N AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFC53267
UniProt: A0A1X2L1G3
LinkDB All DBs
Position
complement(1839919..1840929)
Genome map
AA seq 336 aa AA seqDB search
MKQATVIAVGETGLLDVPKPQTGPNDVLLRMRACGVCGSDGIYISMGGVPPMQGRMPLGH
EPAGEVVEVGADVVGIQVGDHVVVNPMSAPSGIIGNGGTTGALAPYLLIENAARGRSLEV
IPDHIPWEVAALNEPMAVALHGANRCNPRTGDKVVVFGAGPVGLGAILAFKSLGVGHVVV
VDPISGRLEKALQVGANAVIDPTEEDVVTRLLELHGEGESMFGGRVGTDVYLDAAGANAV
VDTVLSAAKRDARLTIVGVHKEPVSVELLNVMGNEIEIVGSCGYPDEIFEVTKDLVANWQ
KYAVIISHTIPFDDVEEALRLAATPGAADKVVVTFP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagcgacagtcattgccgtcggcgagacggggttactcgatgttccgaagccg
caaaccggaccgaacgacgtcctgttgcgaatgcgtgcctgcggcgtgtgtgggtccgac
gggatttacatatccatgggcggggtcccaccgatgcagggtcgcatgcctctgggccac
gaacccgccggtgaagtcgtcgaggtgggcgcggacgtcgtagggatccaggtcggcgat
cacgtggtcgtcaacccgatgagcgccccgagcggcatcatcggaaacggcggcaccaca
ggggcgttggcaccgtacctactcatcgagaacgcggcgcggggacgcagtctcgaggtc
atacccgaccacataccgtgggaggtcgcagcgctcaacgagcccatggccgtcgccctg
cacggcgccaatcgctgcaaccctcgaaccggagacaaggtcgtcgtcttcggcgccgga
ccggtgggcctcggggcaatactggcgttcaaatcgctcggcgtgggccacgtggtcgtg
gtcgacccaatttcgggccgtctcgaaaaggcgctgcaggtcggcgccaacgccgtgata
gatcccaccgaggaggacgtcgtcacccggctcttggaactgcacggcgagggcgagtcg
atgttcggcggtcgggtcgggactgatgtctacctcgacgctgctggcgcgaacgccgtc
gtcgacaccgtcctgtcggcggcgaagcgggacgcgcgattgaccatcgtgggcgtccac
aaggaacccgtgtccgtggagctgctcaacgtgatgggcaacgaaatcgagatcgtcgga
tcctgtggatacccggacgaaatcttcgaggtgacaaaggatctggtggccaactggcag
aagtacgccgtcatcatcagccacacaattccgttcgatgacgtcgaggaggcactgcgg
ctggcggccacccccggcgccgcggacaaggtcgtcgtgacgttcccctga

DBGET integrated database retrieval system