KEGG   Mycobacterium paraintracellulare: OCQ_19250Help
Entry
OCQ_19250         CDS       T01755                                 

Definition
(GenBank) rocE
Organism
mir  Mycobacterium paraintracellulare
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease IBV_3C
Motif
Other DBs
NCBI-ProteinID: AFC53437
UniProt: A0A1X2KH36
LinkDB All DBs
Position
2028757..2030211
Genome map
AA seq 484 aa AA seqDB search
MAATSVGLKEQLLRRRPVVGAHVAPGAAEGLKRGIGTFQLTMFGVGSTIGTGIFFVMSVA
VPEAGPGVIVSFLLAGLAAGLAALCYAELASAVPVSGSSYSYAYTTLGEVVAMGVAACLL
LEYGVATAAVAVNWSGYLNRLLSNVVGFQLPHALSAAPWDAQPGYLNVPAIALIGMCALL
LIRGASESAKVNAIMVMIKLGVLVVFAIVAFTAFDAHHLRDFAPFGVAGIGSAAGTIFFS
YIGLDAVSTAGDEVNNPQKTMPRALIAALLTVTGVYVLVAVAALGAQPWQAFAGQQEAGL
ATILENVTHGSWAGSILAAGAVISIFSVTLVTMYGLTRILFAMGRDGLLPARFAKVNPRT
MTPVNNTVIVALAASTLAAFVPLQKLADMVSIGTLTAFVVVSVGVIVLRVREPDLPRGFK
VPGYPVTPVLSVAACGYILASLHWYTWVAFSGWVVLALVFYFVWGRHHSALNDETVGEVS
SGSP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttggcagccacgtcggttggcctgaaggagcagctgctgcggcgccgcccggtggtgggc
gcgcacgtcgcgcccggtgccgcggagggcctcaagcgcggcatcggcacctttcagctg
accatgttcggggtcggctcgaccatcggcaccggcatcttcttcgtcatgtccgtggcc
gtgcccgaggccgggccgggagtcatcgtctccttcctgctggcgggcctcgccgccggc
ctcgcggccctgtgctacgccgaattggcctcggcggtgccggtttcgggttcgtcgtac
tcgtacgcgtacaccacgctcggggaggtggtggcgatgggcgtggcggcctgcctgctt
ctggaatacggggtggccaccgccgctgtcgcggtcaactggagcggctacctcaacagg
ctgctgagcaacgtggtgggatttcaactgccacatgccttgtcggccgcgccgtgggac
gcgcagcccggctatttgaacgtgccggcgatcgcgctgatcgggatgtgcgcgttgctg
ctcatccgcggcgccagcgaatcggcgaaggtcaacgccatcatggtgatgatcaagctc
ggcgtgctcgtcgtgttcgcgatcgtcgccttcaccgcgttcgacgcgcaccacctgcgg
gacttcgcgccgttcggcgtcgcgggcatcgggtcggccgcgggcaccatcttcttctcc
tacatcggcctcgatgccgtgtccaccgcgggtgacgaggtgaacaacccgcagaagacc
atgccgcgcgcgctgatcgccgcgctgctgaccgtcaccggcgtctacgtattggttgcg
gtggccgcactgggcgcgcagccctggcaagctttcgccggacagcaggaggccgggctg
gcaacgattctcgagaacgtcacccacgggagctgggctggctcgatcctcgctgcgggc
gcggtcatttcgatcttcagcgtcacgctggtcaccatgtacggcctgacgcgcatcctg
ttcgccatggggcgggacggcctgctgcccgcgaggttcgcaaaagtgaacccgcgcacc
atgaccccggtgaacaacacggtgatcgtcgcgctcgcggcctcgacgttggccgccttc
gtcccgctgcaaaagctcgcggacatggtgtccatcggcaccctgaccgcgttcgtggtg
gtttctgtcggagtgatcgtcttacgggtgcgcgagcccgacttgccgcggggcttcaag
gtcccgggttaccctgtcacgccggtcctttcggtggcggcctgcgggtacatcctcgcc
agcctgcactggtacacctgggtcgcgttcagcggctgggtcgtgctggcgttggttttc
tatttcgtctggggccgccaccacagcgcgctcaacgacgagacggtcggcgaggtttcg
agcggctcgccgtga

DBGET integrated database retrieval system