KEGG   Mycobacterium paraintracellulare: OCQ_34180Help
Entry
OCQ_34180         CDS       T01755                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00250  Alanine, aspartate and glutamate metabolism
mir00280  Valine, leucine and isoleucine degradation
mir00410  beta-Alanine metabolism
mir00640  Propanoate metabolism
mir00650  Butanoate metabolism
mir01100  Metabolic pathways
mir01120  Microbial metabolism in diverse environments
Module
mir_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    OCQ_34180
   00650 Butanoate metabolism
    OCQ_34180
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCQ_34180
   00280 Valine, leucine and isoleucine degradation
    OCQ_34180
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCQ_34180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mir01007]
    OCQ_34180
Enzymes [BR:mir01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     OCQ_34180
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     OCQ_34180
Amino acid related enzymes [BR:mir01007]
 Aminotransferase (transaminase)
  Class III
   OCQ_34180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFC54930
LinkDB All DBs
Position
3674392..3675735
Genome map
AA seq 447 aa AA seqDB search
MVAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLI
DLGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKR
SVLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAP
EVYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIV
PAEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPL
SAVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLL
RLQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQKLTVAAQAAGVIVLTCGMFGNII
RLLPPLTIGDELLAEGIEILSGLLRDL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcg
ctggaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccc
gtcttcgtggcgcgcgccggcggcggcatcatcgaggacgtcgacggcaaccggctcatc
gacctcggctccggcatcgcggtgacgactatcggcaactcggcgccccgggtggtcgac
gcggtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgag
tcgtacgtcgcggtggccgagacgctcaaccggatcaccccgggctccggcgagaagcgc
tcggtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgcgcc
tacacgcgcaagtcggcggtggtggcgttcaaccacgcctaccacggccgcaccaacctg
acgatggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccg
gaggtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggagctg
gccaccgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggc
gccgacaacctggccgccctcctgatcgagccgatccagggcgaaggcgggttcatcgtg
ccggccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttc
atcgccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacac
gagggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctg
tcggcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcggcggc
accttcggcggcaaccccctggcctgcgcggcggcgttggccacgatcgagacgatcgag
agcgacgggctggtcgagcgggcccagcagctggaacggctgatcaccgaaccgctgctg
cggctgcaggccggcgacgaccggatcggcgacgtccgcggccgcggcgcgatgatcgcg
atcgagttggtgaagtcggggaccgccgagcccgacaaggagctgacccaaaagctgacc
gtcgccgcccaggccgccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatc
cggctgctgccgccgctgaccatcggcgacgagttgctggccgagggaatcgagatcctg
agcgggttgttgcgcgacctgtaa

DBGET integrated database retrieval system