KEGG   Mycobacterium paraintracellulare: OCQ_37700Help
Entry
OCQ_37700         CDS       T01755                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00473  D-Alanine metabolism
mir00550  Peptidoglycan biosynthesis
mir01100  Metabolic pathways
mir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    OCQ_37700
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OCQ_37700
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    OCQ_37700
Enzymes [BR:mir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     OCQ_37700
Peptidoglycan biosynthesis and degradation proteins [BR:mir01011]
 Precursor biosynthesis
  Amino acid ligase
   OCQ_37700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFC55282
UniProt: A0A1X2LAI2
LinkDB All DBs
Position
complement(4002694..4003839)
Genome map
AA seq 381 aa AA seqDB search
MNASDRSTPHPGSGGGERARVAVVFGGRSNEHAISCVSAGSILRNLDPERFEVVAIGITP
EGSWVLTDGDPAALAITDRRLPEVTAESGTELALPADPRRGGQLVALPPGAGEVLASVDV
VFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLFAAEGLPVGDYAVL
RPSRARLRPEECQRLGLPVFVKPARGGSSIGVSRVASWDQLDAAVAAARRHDPKVIVEAA
IVGRELECGVLEMPDGTVEASALGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDD
EIADTVRQLAVRAFKAIDCQGLARVDFFLTEDGPVLNEINTMPGFTTISMYPRMWAASGV
DYPTLLATMVETALARGVGLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgccagcgatcggtcgacgccgcaccccggctcggggggcggcgagcgggcgcgc
gtggccgtcgtcttcggggggcgcagcaacgagcacgccatctcgtgcgtctcggcgggc
agcattctgcgcaacctcgaccccgagcgtttcgaggtggtcgcgatcggcatcaccccg
gaaggttcctgggtgctcaccgacggcgacccggccgcgctggcgatcaccgaccggcgg
ctgcccgaagtcaccgccgagtcgggaaccgaactggcgctgccggccgatccgcggcgc
ggcggccaattggtcgccctgccgcccggcgccggtgaggtgttggcgtccgtcgacgtg
gtgttccccgtgctgcacggcccctacggcgaggacggcaccatccagggtctgctcgaa
ctcgccggcgtgccgtatgtgggcgccggtgtgctggccagcgccgccggcatggacaag
gagttcaccaagaagctgttcgccgccgagggattgccggtcggcgactacgcggtgctg
cgcccctcgcgcgcgcggctgcggcccgaggagtgccagcggctggggctgccggtgttc
gtcaaacccgcccggggaggttcctcgatcggtgtgagccgggtagcgagctgggaccag
ctggacgccgccgtcgccgcggcgcgccgccacgatcccaaagtcatcgtcgaggccgcg
atcgtcggccgcgagctggagtgcggtgtgctcgaaatgcccgacggcacagtcgaagcc
agcgcgctcggcgagatccgggtggcaggcgtgcggggccgcgaggattcgttctacgac
ttcgccaccaaataccttgacgacgcagccgaattggacgtgcccgcaaaggtcgacgac
gaaatcgccgacacagtgcgccaattggcggtccgcgccttcaaggccatcgactgccag
ggtctggcgcgggtggatttcttcctcaccgaggacgggccggtgctcaacgagatcaac
acgatgccggggttcaccacgatctcgatgtacccgcggatgtgggcggccagcggcgtg
gactacccgaccctgctggcgacgatggtcgagacggcgctggcccgcggggtgggcctg
cgctag

DBGET integrated database retrieval system