KEGG   Mycobacterium paraintracellulare: OCQ_47640
Entry
OCQ_47640         CDS       T01755                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00730  Thiamine metabolism
mir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    OCQ_47640
Enzymes [BR:mir01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     OCQ_47640
SSDB
Motif
Pfam: DAO Pyr_redox_2 XdhC_C 3HCDH_N F420_oxidored Pyr_redox 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_8 NAD_binding_2 FAD_binding_2
Other DBs
NCBI-ProteinID: AFC56276
LinkDB
Position
complement(4987087..4988115)
AA seq 342 aa
MTGMPSGPPLGSLAVIGGGVIGLAVARRAAQAGWSVRVHRSGERGASWVAGGMLAPHSEG
WPGEERLLRLGLESLRLWRDGGFLDGLPAGVVTARESLVVAVDRADAADLRTVADWLSAQ
GHPVVWESAARDVEPLLAQGIRHGFRAPTELAVDNRAVLDALEAECERLGVRWAPPVHDL
SAVEADAVVIANGIDAPALWPGLPVRPVKGEVLRLRWRKGCMPLPRRVIRARVHGRQVYL
VPRADGVVVGATQYEHGRDTAPVVSGVRDLLDDACAVLPALGEYELAECGAGLRPMTPDN
LPLVHRLDARTLVAAGHGRSGFLLAPWTAEQIVSELAPVGAH
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaccgggatgccttcgggcccaccgctggggtcgctggccgtcatcggcggcggcgtc
atcgggctggcggtggcgcgccgcgccgcccaggccggctggtcggtgcgggtgcaccgc
agcggggagcggggcgcatcctgggtcgccggcggcatgctggccccgcacagcgagggc
tggccgggagaagagcgattgctgcggctgggcctggaatccctgcggttgtggcgcgac
ggcggtttcctcgacggcctgccggccggagtggtcaccgcccgcgagtcgctggtggtg
gccgtcgaccgcgccgacgccgccgacctgcgcaccgtggcggactggctgtccgctcag
ggacaccccgtggtctgggagtcggccgcccgcgacgtggaacccctactcgcgcagggc
atccggcacggctttcgggcgcccacggagctggccgtggacaaccgggcggtgctcgac
gcgctcgaggcggagtgcgagcgtctcggggtgcggtgggcgccgccggtgcacgacctg
tcggcggtcgaggccgacgcggtggtgatcgccaacggcatcgacgcgccggcgttgtgg
cccgggctgccggtgcgcccggtcaagggcgaggtgctgcgactgcggtggcgcaaaggc
tgtatgccgttgccgcggcgggtgattcgcgcccgggtgcacggccggcaggtctacctg
gtgccgcgcgcggacggcgtggtggtcggcgcgacccaatacgagcacgggcgcgacacc
gccccggtcgtctcgggggtgcgtgacctcctcgacgacgcctgcgcggtgctgccggcg
ctcggtgaatacgagctagccgagtgcggggccgggctgcgcccgatgacacccgacaat
ctgccgttggtgcatcgcctggacgcgcgcacgctggtcgccgccggccacggccggtcg
gggttcctgctggcgccctggacggcagaacagatcgtttccgaactggcaccggtggga
gcacactaa

DBGET integrated database retrieval system