KEGG   Mycobacterium paraintracellulare: OCQ_48250Help
Entry
OCQ_48250         CDS       T01755                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00220  Arginine biosynthesis
mir00250  Alanine, aspartate and glutamate metabolism
mir00290  Valine, leucine and isoleucine biosynthesis
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01130  Biosynthesis of antibiotics
mir01210  2-Oxocarboxylic acid metabolism
mir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCQ_48250
   00290 Valine, leucine and isoleucine biosynthesis
    OCQ_48250
   00220 Arginine biosynthesis
    OCQ_48250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mir01007]
    OCQ_48250
Enzymes [BR:mir01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     OCQ_48250
    2.6.1.66  valine---pyruvate transaminase
     OCQ_48250
Amino acid related enzymes [BR:mir01007]
 Aminotransferase (transaminase)
  Class I
   OCQ_48250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFC56337
LinkDB All DBs
Position
5051120..5052397
Genome map
AA seq 425 aa AA seqDB search
MTTHQLPHQLPPHPSAHHRQQRTFAQSSKLQDVLYEIRGPVHQQAARLEAEGHRILKLNI
GNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFDVDDVY
LGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQPDIA
DMESKITDRTKALVVINPNNPTGAVYTSEVLTQIVELARKHELLLLADEIYDKILYGDAK
HINLASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANMRLCPN
VPAQHAIQVALGGYQSIDDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPDGALYAFPRLD
PEVYDIDDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLAAAIERLGNFL
VAYRQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccaccagctgcctcatcagctgccaccgcacccgtcggcccatcaccggcag
cagcgcactttcgcgcagtcgtcgaagctccaggacgtcctgtacgagatccgcggcccg
gtacatcagcaggccgcgcggctggaggccgagggtcatcgcatcctcaagctcaacatc
ggcaacccggcgccgttcggcttcgaggcgcccgacgtgatcatgcgcgacatgatccag
gccctcccgtacgcgcagggttactccgactcgcagggcatcctgccggcccgccgcgcg
gtggtcacccgctacgagttggtcgacggattcccccgcttcgacgtcgacgacgtctac
ctgggcaacggggtctccgagctgatcacgatgacgctgcaggccctgctcgacaacggt
gacgaggtgctgatcccgtcacccgactacccgctgtggacggcgtcgacgtcgctggcg
ggcggcaccccggtgcactacctgtgcgacgagacgcagggctggcagcccgacatcgcc
gacatggagtccaagatcaccgaccgcaccaaggcgctggtggtgatcaacccgaacaac
ccgaccggcgcggtgtacaccagcgaagtgctcacgcagatcgtcgaattggcgcgcaag
cacgagctgctgctgctcgccgacgagatctacgacaagatcctctacggcgacgccaag
cacatcaacctggcctcgctggcgccggacatgttgtgcctgacgttcaacgggctgtcc
aaggcctaccgggtggccgggtatcgggccggctggctggcgatcaccgggcccaaggac
cacgccggcagcttcatcgaggggatcaacctgctggccaacatgcgcctgtgccccaat
gtcccggcgcagcacgcgatccaggtcgccctgggcggctaccagagcatcgacgacctc
gtcctgcccggcggccggctgctcgagcagcgcgacgtcgcctggaccaagctcaacgag
attccgggggtgtcctgcgtcaagccggacggcgctctctacgccttcccgcggctggac
cccgaggtctacgacatcgacgacgacgagcagctcgtcctcgatttgctgctgcaggag
aagattctggtcacccagggcaccggcttcaattggcccgcaccggatcacctgcgcatc
gtgaccctgccgtgggcccgcgatctggcggcggccatcgagcggctgggcaacttcctc
gtcgcctatcgccagtaa

DBGET integrated database retrieval system