KEGG   Micromonas commoda: MICPUN_104763Help
Entry
MICPUN_104763     CDS       T02695                                 

Gene name
PEPC
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mis  Micromonas commoda
Pathway
mis00620  Pyruvate metabolism
mis00710  Carbon fixation in photosynthetic organisms
mis01100  Metabolic pathways
mis01200  Carbon metabolism
Module
mis_M00168  CAM (Crassulacean acid metabolism), dark
mis_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MICPUN_104763 (PEPC)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MICPUN_104763 (PEPC)
Enzymes [BR:mis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MICPUN_104763 (PEPC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 8241081
NCBI-ProteinID: XP_002499417
JGI: MicpuN3_104763
UniProt: C1DZM5
LinkDB All DBs
Position
2:166867..169815
Genome map
AA seq 982 aa AA seqDB search
MPKQAIKDEAIKDAVVGSQYLAGTGESTQFDHHQVLQESDDLIRALFFSIVKETTGTEFF
QSLKDVYDLSEKFHETQAQSDFDALTTKLGSLTNEETMMLASAFSNVLNLHNVSEHVASA
MEERHARLDDIPRGPAKTTNGAIKGLVAKGISKEAIYKAITEQEVDLVLTAHPTQALRRS
MLKNFGTVRQKLLDLQRARLSGYERAELLDSMASAIQSAWRTDEIRRTPPKPQDEMRAGL
SYFNETVFEGLPKFCRRIDSALINQGLPRIPMEHSIMRFSSWMGGDRDGNPFVTATCTRD
VVYLARITAVNLYFKAIQDLIFSLSMWRCTDAFRERARLLHERESAEHVYEMRKQRNYAD
FWRSLPMEEPYRVVLAEVRDKLYNTREALQAVIMGKAEALDPADDSIFRDKNQLLEPLMA
CHQSLIEVGDGTVADGSLLDLIRQVNCFGLSLVKLDIRQESDRHADAVDAITRHIGLGSY
NDWDEEKKTEWLVSELKSKRPLVASDLECTDDVREVLDTFKMIAHLQEVCPGSLGTYVIS
MATVASDVLAVVLLQREMGGKMDQLLRVAPLFERLDDLNEGPNQLRRLFSIPWYHELIDG
HQEVMIGYSDSGKDAGRMAAAWALYEGQENATKVADEFGVKLTLFHGRGGTVGRGGGPSH
LAILSQPPATINGRLRVTVQGEVIEQNFGEHENCFHTLDLYTAATLEHSLAPPLAPSDEW
RGAMATMSEVSCERYREIVFKTPEFNPYFLQATPGQELGALNIGSRPAKRKSNAGVTALR
AIPWIFAWTQSRFHLPVWLGIAEGFQRVKEQGKLETLREMYRTWPFFRVTMDLIEMVLAK
ADPTVARLYEKELVEEQYHAFGEQLRKALRSTVDIVLEVTEHPDLLTSQTTNGGQGSINT
LKDKLAMRSIYLTPLNIIQVENLKRLRDIEDGKVDTKGYVPVMPWAKQMLSLHVSKDYYH
AAVSDTLIITMKGIAAGMQNTG
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcaggcgataaaggatgaggccatcaaggacgcggtggttggctcgcagtac
ctcgcggggacgggcgagtccacccagttcgatcaccaccaggtgctgcaagagtccgac
gatctgatccgcgcgctgttcttcagcatcgtcaaggagaccaccggcacggagttcttc
cagtcgctgaaggatgtgtacgatctgtccgagaagttccacgagacgcaggcgcagtcc
gacttcgacgcgctcaccaccaagctcggatcgctgacgaacgaggagacgatgatgctg
gcgtccgcgttttcgaacgtgctcaacctgcacaacgtgagcgagcacgtggcgagcgcg
atggaagagaggcacgcgaggctcgacgacatcccccgcggccccgccaagaccaccaac
ggcgccatcaagggcctcgtcgccaaggggatctcgaaggaggcaatctacaaggccatc
accgagcaggaggtggacctcgtgctcaccgcgcaccccacccaggcgctccgcaggtcc
atgctcaagaacttcggcaccgttcgccagaagctcctcgacctccagcgcgcgcgcctc
tccgggtacgagcgcgcggagctcctcgactcgatggcgtcggcgatccaatccgcctgg
cgaaccgacgagattcgcaggacgcccccgaaaccccaggacgagatgcgcgccgggctg
tcctacttcaacgagacggtgttcgagggtctgccgaaattctgcaggcgtatcgactcc
gcgctcatcaaccagggcctgccgaggatccccatggagcactccatcatgcgattcagc
agctggatgggcggcgatcgcgacggaaatcccttcgtcaccgccacctgcacccgcgac
gtcgtgtacctggcgcgcatcaccgccgtgaacctctacttcaaggcgatccaggacctc
atcttctcgctgtccatgtggaggtgcaccgacgcgtttcgagagcgcgccaggcttctg
cacgagagggaatctgccgagcacgtgtacgagatgcgcaagcagcgcaactacgcggac
ttctggcggtcccttcccatggaagaaccctaccgcgtcgtgctcgcggaggttcgcgat
aagctctacaacacccgcgaggccctccaggctgtgatcatgggcaaggcggaggcgctc
gaccccgcggacgactcgatcttccgcgacaagaaccagctgctggagccgctgatggcg
tgccaccagtcgctcatcgaggtgggcgacggcaccgtcgcggacggctcgttgctcgat
ctgatccgccaggtgaactgcttcggcttgtctttggtcaagctggacatccggcaggag
agcgatcgtcacgcggacgcggttgacgccatcactcggcacatcggcctcggttcgtac
aacgactgggacgaggagaagaagacggagtggctcgtgtcggagctcaagtccaagcgc
ccgctcgtggcgtccgacctggagtgcaccgacgacgtccgcgaggtgctcgacaccttc
aagatgatcgcgcacctccaggaggtgtgcccgggctccctcgggacgtacgtcatctcc
atggccaccgtggcgtcggacgtgctggcggttgttttactccagcgggagatggggggc
aagatggaccagctcctccgcgtcgcgccgctgttcgagcgcctggacgacctcaacgag
ggcccgaaccagctgcgcaggctcttctccattccgtggtaccacgagctcatcgacggc
caccaagaggtgatgatcggatactccgactcgggcaaagacgcgggccgcatggccgcg
gcttgggcgctgtacgaggggcaggaaaacgccacgaaggttgccgacgagtttggggtg
aagctcacgctcttccacggccgcggagggaccgtcggaagaggcggcgggccctcgcac
ctcgccatcctgtcgcagccgccggcgaccatcaacgggcgcctcagggtcaccgttcag
ggcgaggtcatcgagcaaaactttggcgagcacgagaactgcttccacacgctcgacctc
tacaccgccgcgactctggagcactccctcgcgccgccgctcgcgcccagcgacgagtgg
cgcggcgccatggccaccatgtcggaggtgtcctgcgagcggtatcgcgagatcgtgttc
aagacacccgagttcaacccctacttcctccaggccaccccgggtcaggagctcggcgcg
ctcaacatcggctcgcgcccggcgaagcgcaagagcaacgcgggcgtcaccgcgctgcgc
gccatcccctggatcttcgcgtggacccagtcgcggttccatctccccgtctggctcggc
atcgcggagggattccagcgcgtgaaggagcaggggaagctcgagacgctccgggagatg
tacaggacctggccgttcttccgggtcaccatggacctcatagagatggtcctcgccaag
gcggaccccaccgtcgcgcggctctacgagaaggagctcgtcgaggagcagtaccacgcc
tttggcgagcagctccgcaaggcgcttcgtagcaccgtcgacatcgtgctcgaggtgacc
gagcaccccgacctgctgacgtcgcagacgaccaacggcggccagggcagcatcaacacc
ctcaaagacaagctcgccatgcgcagcatctacctcacgccgctcaacatcatccaggtt
gagaacctcaagcgtctgcgcgacatcgaggatggcaaggttgacaccaaggggtacgtg
ccggtgatgccgtgggccaagcagatgctcagcctccacgtgtccaaggactactaccac
gccgcggtgtcggacacgctgatcatcaccatgaagggcatcgccgcggggatgcagaac
accggctaa

DBGET integrated database retrieval system