KEGG   Micromonas commoda: MICPUN_106467Help
Entry
MICPUN_106467     CDS       T02695                                 

Gene name
SDH2
Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mis  Micromonas commoda
Pathway
mis00020  Citrate cycle (TCA cycle)
mis00190  Oxidative phosphorylation
mis01100  Metabolic pathways
mis01110  Biosynthesis of secondary metabolites
mis01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MICPUN_106467 (SDH2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MICPUN_106467 (SDH2)
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MICPUN_106467 (SDH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl DivIVA Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 8248556
NCBI-ProteinID: XP_002505866
JGI: MicpuN3_106467
UniProt: C1EFN9
LinkDB All DBs
Position
13:complement(join(993262..995051,995324..995456))
Genome map
AA seq 640 aa AA seqDB search
MSLRRKIIGAAARWAGSSAAPQWARQAVCGFHSTGAASAAAGAPGKSAYTIIDHEYDAVV
VGAGGAGLRAAIGLSEHGLKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDT
IKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTDDGKIYQRAFGGQSLDYGKGGQA
YRCACAADRTGHAMLHTLYGQALKHDTQFFVEYFALDLIMHEGECVGVVAMCMEDGTIHR
FRSHKTVLATGGYGRAYFSATSAHTCTGDGNAMVTRAGLPMQDLEFVQFHPTGIYGAGCL
ITEGSRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYL
HLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGEVLTLGS
DGKDTVVPGLLAAGECASSSVHGANRLGANSLLDIVVFGRACANTIAETLKPGTPHKKIP
SDAGENAVAHLDKVRWSNGQHSTADVRKTMQRVMQDDAAVFRTQETLAEGVKKIDEVAAR
LDDLKVTDKSMVWNTDLIEALELHNLMPNAQITMHSAEQRKESRGAHAREDFPDRDDANW
MKHTLGWVDDKRKVNIDYRAVIQTPLDDEMEHVPPKARVY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccgccggaagatcatcggcgcggcggcgcggtgggctggctcgtccgccgcc
ccgcaatgggcccgtcaggctgtctgcgggttccactccaccggcgcggcgtccgccgcc
gcaggagcgcccggcaaaagcgcttacaccattatcgaccacgagtacgatgccgtcgtc
gttggtgcgggtggcgcgggtcttcgagccgccatcggcttgtccgagcacggtctcaag
acggcgtgcatcaccaagctcttccccacgcgctcgcacacggttgccgcgcagggtggc
atcaacgcagctctcggcaacatgacggaggatgactggaggtggcatgcgtacgacacc
atcaagggctcggactggctcggagaccaggacgccatccagtacatgtgtcgtgaggcg
cccaaggctgtgatcgagctcgagaactacggcttgccgttcagtcgcaccgacgacggc
aagatctaccagcgcgcttttggcggccagtcgctggactacggcaagggtggccaggca
tacaggtgtgcgtgcgccgcggacaggacggggcacgcgatgcttcacaccctgtacgga
caggccctgaagcacgacacccaattcttcgtggagtactttgcgctcgatctcatcatg
cacgagggcgagtgcgtcggcgtggtcgcgatgtgcatggaggacggcaccatccacagg
ttcaggtcgcacaagaccgtcctggccacgggtggctacgggcgcgcgtacttctccgcg
acgtccgcgcacacgtgcacgggagacggtaacgcgatggtgactcgcgcgggtctcccc
atgcaagatctcgagtttgtccagttccaccccaccggcatctacggcgctgggtgcctc
atcaccgagggttcgcgaggtgagggaggtatcctgaggaacagcgagggtgagcgcttc
atggagcgttacgcgccttccgccaaggatcttgcctctcgcgacgtcgtgtctcgctcc
atgaccatcgagattcgcgagggacgaggcgtcgggccggagaaggaccacatctacctc
cacctcaaccacctccccccggagctcctcgccgagcgtctgcctggcatctccgagact
gccgcgatcttcgccggggttgacgtcaccaaggagcccatcccggtcattcccacggtg
cattacaacatgggtggcatacccaccaactacaagggcgaggtactgaccctgggctcc
gacggtaaggacacggttgtcccgggcctgctcgccgcgggtgagtgcgcgagttcctcc
gttcacggtgcaaaccgcttgggcgccaactcccttctcgacatcgtcgtgttcggccgc
gcctgcgcgaacaccatcgctgagaccctcaagcctggcacgccccacaagaaaatcccc
tccgacgcgggcgagaacgctgtggcgcacctggacaaggttcgatggagcaacggccag
cactcaacggcagacgtcaggaagacgatgcagagggtgatgcaggacgacgccgccgtg
ttccgcacgcaggagaccctggccgagggtgtgaagaagatcgacgaggtcgccgcccgt
ttggatgacctcaaggtgacggacaagagcatggtgtggaacaccgacctcatcgaggcg
ctcgagctccacaacctgatgcccaacgcgcaaatcaccatgcactctgccgagcagcgc
aaggagagccgcggcgctcacgctcgcgaggacttcccagaccgcgacgatgccaactgg
atgaaacacacccttggttgggtcgatgacaagcgcaaggtgaacatcgactaccgtgcg
gtcattcagaccccgctggacgacgagatggagcacgtgccccccaaggcgagggtgtac
taa

DBGET integrated database retrieval system