KEGG   Micromonas commoda: MICPUN_56330Help
Entry
MICPUN_56330      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mis  Micromonas commoda
Pathway
mis00071  Fatty acid degradation
mis00410  beta-Alanine metabolism
mis00592  alpha-Linolenic acid metabolism
mis00640  Propanoate metabolism
mis01040  Biosynthesis of unsaturated fatty acids
mis01100  Metabolic pathways
mis01110  Biosynthesis of secondary metabolites
mis01200  Carbon metabolism
mis01212  Fatty acid metabolism
mis04146  Peroxisome
Module
mis_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MICPUN_56330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MICPUN_56330
   00592 alpha-Linolenic acid metabolism
    MICPUN_56330
   01040 Biosynthesis of unsaturated fatty acids
    MICPUN_56330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MICPUN_56330
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MICPUN_56330
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     MICPUN_56330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 8241165
NCBI-ProteinID: XP_002499971
JGI: MicpuN3_56330
UniProt: C1E031
LinkDB All DBs
Position
2:complement(489280..490944)
Genome map
AA seq 554 aa AA seqDB search
MPYISVDALVGDGPVAPPPTLADGGRVSENALRDWGAPPANVDEDPKRVAWRANYTAELA
RVLNTPADDYHDSAARLSGLVKSALLEFRHLKTEPSKFFEAHRLLVNHGFEQGPGFSIRF
TVQYNLFAGTVLELGGPEHLRTLDEMQRNGELGCFALTEKLAGVNSGLVVQTTARWVPDE
GAFLLHTPHDGACKNWISQGLTACKAVVMADLIVGGESKGPHAFLVELRAKGSGPGYPGR
TSTGVTLGDMGAKTTGNDLDNAWISFENKWIPRESLLDRYCDLTVDGGYVPRGGTSAPMS
NMELIGQRLFTGRVAVAQGAHEFRRRLFRRTRAHNDAKPCWAPGGGSHSAKKTLMLSSVP
QLRALYRDADAKEARMTAYLASVERDLCETLTNGTRPSAEMVEAVAAAKVSAVDEAIEYC
HRLKQEVGSYALMAGTGFEHTDFLQCCKFAEGDSRILLMKVARDRVKAYGRIAAKGGEFP
SWMSPREAKAVAELAKALQASAAGGKRPAEAWEEHWDKAYATARLAVDDIVTRRVGGPDK
WSNAGWRSTPASRL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgccttacatctccgtcgacgccctcgtgggtgacggacccgtggctccgcccccaacg
ctcgccgacgggggccgcgtctcggaaaacgccctccgagattggggcgctccacccgcg
aatgtcgacgaggacccgaagcgcgttgcgtggcgcgcaaactacaccgccgagctcgcg
cgcgtgctcaacacccccgcggacgactatcacgactccgccgcgcgactcagcggcctc
gtcaagtccgcgctcctcgagttccggcacctcaagacggaaccgtccaagttcttcgag
gcgcaccggctgctcgtcaatcacggcttcgagcaggggccgggattcagcatcaggttc
acggtccagtacaacctcttcgccgggaccgtgctcgagctcggaggtcccgaacacctg
aggacgctcgacgagatgcagcgaaacggcgagctcgggtgctttgcgctcaccgagaag
ctcgcgggcgtcaactccgggctggtggttcagacgacggcgaggtgggtcccggatgag
ggcgcgttcctgctgcacacgccccacgacggcgcgtgcaagaactggatctcgcagggt
ctgacggcgtgtaaagcggtggtcatggcggacctcatcgtcggcggcgagagcaaggga
cctcacgcgttcttggtcgagcttcgcgcgaaaggttccgggccggggtatcccggccgg
acatcgacgggggtgaccctcggggacatgggcgccaagaccacgggtaacgacctggat
aacgcgtggatatccttcgagaataagtggatcccgcgcgagtccctcctggaccgatac
tgcgacttgaccgtcgacggcggatacgtcccacggggcggaacctcggcgccgatgtcg
aacatggagctcatcggccagcgcctcttcaccggccgagtcgccgtggctcagggggcg
cacgagttcaggcgccggctgttccgcagaacgcgagcgcataacgacgcgaagccgtgc
tgggctcccggcggcggcagccacagcgccaagaagacgctgatgctgtcgtcggtgccg
cagctgagagccctgtatcgcgacgccgacgcgaaggaggcgaggatgaccgcctacctg
gcctcggtggaacgggacctgtgcgagacgctcacgaacggtacgaggcccagcgcggag
atggtcgaggcggtggcggcggcgaaggtctccgcggtggacgaggcgatcgagtactgc
cacaggctgaagcaggaggttggctcctacgcgctgatggccggcaccgggtttgagcac
acggactttcttcagtgctgcaagtttgccgaaggcgacagcaggatcctgctcatgaag
gtggcgcgcgatagggtcaaggcgtacggtcgcatcgcggcgaagggcggcgagtttccc
tcgtggatgtcgccgagggaggcgaaggcggtggctgagctggcgaaggcgctccaagca
tccgccgccgggggaaagaggccagcggaggcttgggaggaacactgggacaaggcgtac
gccaccgcgaggttggcggtggatgacatcgtgaccagacgcgtaggcgggccggataag
tggtccaacgctgggtggcgctcgacgcctgcgagccggttatag

DBGET integrated database retrieval system