KEGG   Micromonas commoda: MICPUN_60122Help
Entry
MICPUN_60122      CDS       T02695                                 

Definition
(RefSeq) ribokinase/xylose isomerase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mis  Micromonas commoda
Pathway
mis00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MICPUN_60122
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MICPUN_60122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB AP_endonuc_2 Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 8244918
NCBI-ProteinID: XP_002503627
JGI: MicpuN3_60122
UniProt: C1EAM3
LinkDB All DBs
Position
7:808288..810438
Genome map
AA seq 716 aa AA seqDB search
MATWRVFTRTVYTAIAVIILIASPDVSFAAEQPSCGAPPPHIVVVGSVNVDLTVKVARPP
ALEETVTATDPRVSVAVGGKGANQAVAAARLVAGSRPVRFVGQFGGDSHASMLEQELVAN
GVDVSLSGRHPDLPSGTGLVMLSPGGEASSVVVGGANSAWPENDDELVSTMVRAARGAAV
MLLQREVPDRVNLAAAAAAKAAGVPIVVDAGGVDAPIPAALLEAADYLCPNESELARLTR
MPTSTDDEAVAAGLELVAQGAKRVLVTLGARGAMVIGATGVIARHDALPVPGGEVGKVGE
VVDGTAAGDAFRAALAVAVAEGVDVVKDSRGLALAAAAGAHAVSVPGAVPSLPTRDEAEN
LIPEHRHLPAPALAATKACEETDAALRDDECPLRFGSRLNSMKERPDLWSGRERLDVLGM
VRRLGEVEGIDLVDFNYPQHLDGRKPKAVTGALRAAGLAAGAVAVRFPASRFRAGAFTNP
DPSVRAAAVDVVAGACAWARSLDASAGVIVWPQFDGYDYHLQVNYSDAWRRGVGAIRAAL
DRDECEGVKVSYEFKPTDPSSRFALVPSTAAALALVRDVNRPGRFGLTLDAGHLVAAGEN
PAQSAAMVADAGALFGFHLGDVHSKLAAEDGLAFGSVHAPGALELVFWLRASGYRGHAYF
DTFPEAEDPTREAAYNVRAFKRMWSWAARLERDGIRDVLLNHDAMTSLEMQEGLIA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatggcgggtcttcacccgcaccgtgtacaccgcgatcgcggtcataattctt
atcgcgtcgccggatgtatcgttcgccgcggagcagccatcatgtggagccccgcccccg
cacatcgtggtcgtgggatccgtaaatgttgatttgacggtgaaggtcgcgaggccgccc
gcgttggaggagaccgtcacggcgacggacccgcgcgtgagcgtcgccgtcgggggtaaa
ggtgcgaaccaggccgtcgccgccgcgcgcctcgtcgcgggctcgaggccggtgaggttc
gtcggccagttcggcggcgattcacacgcgtcgatgctcgagcaggagctcgtggcgaac
ggcgtcgatgtctccctgagcggacgccacccggaccttccctcggggacgggcctcgtc
atgctctcgcccggcggcgaggcgtcgtccgtggtcgtcggcggcgccaactccgcgtgg
cccgagaacgacgacgagctcgtgtcgacgatggtccgagcagcgaggggcgccgcggtg
atgctgctgcagcgggaggtccccgacagggtcaacctcgcggccgcggcggctgcgaag
gccgcgggggttcccatcgtcgtggacgccgggggcgtggacgctcctatacccgccgcg
ctgctcgaggcggcggattacctctgcccgaatgagtccgagctggcgaggctcacccgc
atgccgacgtcgacggacgacgaggcggtcgccgcgggcctcgagctcgtcgcccaaggc
gccaagcgcgtgttggtcaccctcggcgcgcgcggcgcgatggtcatcggcgcgaccggc
gtgatcgcgcggcacgacgcgctgccggtaccgggcggtgaggtcggtaaagtcggtgag
gtcgtggacggcaccgcggcgggcgacgcgttccgggcggcgctcgccgtcgccgtcgcg
gagggcgtcgacgtcgtgaaggattcccggggtttggcgctggccgcggcggcgggggcg
cacgcggtgagcgtcccgggcgctgtgccgtcgcttcccacgcgtgacgaagcggagaat
ctcatccccgagcaccgacatctccccgcgccggcgctcgcggcgacgaaagcgtgcgaa
gaaaccgacgccgcccttcgcgacgacgagtgcccgcttcgattcggctccaggctcaac
tccatgaaggagcgccccgacctgtggagtgggcgcgagcggctcgacgtcctcggcatg
gttcgcaggctgggcgaggtcgagggtatcgacctcgtggacttcaactacccccagcac
ctcgacggtcgaaagccaaaggctgtgaccggcgcgctgagagcggctggtctcgccgcc
ggcgcggtggcggtgcggttcccggcgtcgcggtttcgagccggggcgttcacgaacccc
gatccgtccgtccgtgccgcggccgtcgacgtcgtcgcgggcgcgtgcgcgtgggctcgg
tcgctggacgcgtcagccggcgtcatcgtctggccacagtttgacggttacgactaccac
ctccaggtcaactactcagacgcgtggcggcgcggggtgggcgccatccgcgcggctctg
gaccgcgacgagtgcgagggagtgaaggtgtcgtacgagttcaagccgacggatccctcg
agtcggttcgcgcttgttcccagcacggcggcggcgctggcgctggtgagggacgtgaat
cgaccgggacggttcgggctcaccctggacgcgggccacctggtggcggccggggagaac
cccgcgcagagcgccgcgatggtcgccgacgcgggtgccctgttcggcttccacctcggg
gacgtgcactcgaagctcgcggctgaggatgggctcgcgttcgggtcggttcacgcgccg
ggggcgctcgagctcgtgttctggctcagggcgtctggatacaggggccacgcgtacttt
gacaccttccccgaggcggaggatccgacgcgcgaggcggcgtacaatgtccgcgcgttc
aagaggatgtggagctgggcggctcggctggaacgtgacggtattcgcgacgtacttctc
aaccacgacgccatgacgagtctggagatgcaggagggtctcatcgcctag

DBGET integrated database retrieval system