KEGG   Micromonas commoda: MICPUN_62102Help
Entry
MICPUN_62102      CDS       T02695                                 

Definition
(RefSeq) hypothetical protein
  KO
K11274  chromosome transmission fidelity protein 4
Organism
mis  Micromonas commoda
Brite
KEGG Orthology (KO) [BR:mis00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mis03036]
    MICPUN_62102
Chromosome and associated proteins [BR:mis03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    MICPUN_62102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 IKI3 Coatomer_WDAD
Motif
Other DBs
NCBI-GeneID: 8246850
NCBI-ProteinID: XP_002508852
JGI: MicpuN3_62102
UniProt: C1FHJ2
LinkDB All DBs
Position
10:complement(931169..934048)
Genome map
AA seq 959 aa AA seqDB search
MAPPEWNFGHVAGICDVSFVGSGDEALLVTCGADNAVTVRNPETLEIEESFTEEHDDAVN
VLAVSPDGAKFATGSDDNSVKLFNFAGASREFESNVVRFTLPVRALAWSADGTFLAAGGE
DNAVKVVKMDDKSVALDLATRSKCVKSLAFDPKGDFLGAVDDAGVLTVWALKAIAAGDDD
DADMSDGDDDGKKGSTEPGEIVLAATVAPMTEPDSCEVNRACWRPDGAVIAVPGREHDVT
FFARGTWTELENHRLIAEDGSEGKGHGENVVLAQWSPNGKYLLTSAKDHTVCVWDVKERK
VINFIKHESTVCGACWRQTGNAVALVDGDGQWTLWKNPVPPSGYTGPTAQVDAAELDFFE
AEEPLAPLAGGMGDEDMDGEDNVASEDEEDMGDMDEEQYYSELERRKRMKRKLAKSAQGT
AVAAAPTPQPPFQVGSVPAKTAKDDAGNDANGSTRRFLCYNMIGSVVSTGEPGGDFNSVE
MAFHDTSRGGRIPTITDYHGYSVGCLGERGCALASPAKQSGGSSVLFYRPYESWTHKSDW
SVTLPVGEDVVSVATGKDWVAALTSGRMLRVFSHAGAQRQMVQLDGAPVTAAGKGDSLVV
AWHASAPALVPDAADPKVLRVEPRIEFAEYDVASGGKVLSKGRIPLPPGATLTWLGHVED
GNGAIAFGASDGCVRVRTSEFGGSWTPVFRSQDARQQEGEHHWTVAVSVAESALYCVVGG
NANGPAVHPRPVLTPLPLGMPVALPDSSSGELEDAAARAQLCVALASAAAAGDTAGFRDD
VDPAGAAMDALRAAQTEADKALLRLFHAACKGERPARAADVASALNLTTSMHGALKLANA
MSQNVLAERVTNLIEASMAAAAAAAEVEAARVYGGAVELDTPGQAPQQHYSQPAAYVAPS
QATQPEKDSNPLGRRRSVAPATDENADAPKVSAKVKAGYEANAAPAKKGRVANPFARAR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcccgagtggaacttcggccacgtcgccggcatctgcgatgtctccttcgtc
ggcagcggcgacgaagcgctcctcgtcacgtgcggagcggacaacgcggtgaccgtgagg
aacccggagacactggagatcgaggagagcttcaccgaggagcacgacgatgccgtcaac
gtgctcgccgtgagccctgacggcgccaagttcgccaccgggtccgacgacaactccgtc
aagctcttcaacttcgcgggcgcaagccgcgagtttgaatccaacgtggtgcgcttcacc
ctccccgtgcgcgcgctggcgtggagcgccgacggtaccttcctcgccgcaggtggcgag
gacaacgcggtcaaggtggtcaagatggacgacaagtccgtggccctcgacctcgccacc
aggtccaagtgcgtcaagtccctcgcgttcgatcccaagggagacttcctcggcgccgtc
gacgacgccggcgtcctcaccgtgtgggcgctcaaggcgatcgccgccggcgatgacgac
gacgcggacatgtccgacggcgatgacgacggcaagaaagggtcgacggagcccggcgag
atcgtcctcgccgccaccgtcgcgcccatgaccgagccggattcgtgcgaggtgaaccgc
gcgtgctggagaccggacggcgccgtgatcgcggtgcccggccgcgagcacgacgtcacc
ttcttcgcgcgcggtacctggaccgagctcgagaaccacaggctgatcgccgaggacggg
agcgagggcaagggccacggcgagaacgtggtgctcgcgcagtggtcgcccaacggcaag
tacctgctcacctccgccaaggaccacaccgtgtgcgtttgggatgtcaaggagaggaag
gtcatcaacttcatcaagcacgagtccacggtgtgcggtgcgtgctggcgccagaccggt
aacgcggtggcgctcgtggacggcgacgggcagtggaccctgtggaagaacccggtgccc
ccgtcgggttacaccgggcccaccgcgcaggttgacgccgcggagctcgactttttcgag
gccgaggagcctctcgcgcccctcgcgggaggcatgggcgacgaagacatggacggcgaa
gataacgtcgcgtccgaggacgaggaagacatgggcgacatggacgaggagcagtactac
tccgagctagagcgaaggaagaggatgaagaggaagctcgccaagagcgcccagggtacc
gccgtcgccgccgcgcccacgccgcagcccccgttccaggtgggatcggtccctgccaag
actgctaaggatgatgctgggaacgacgcgaacggctcgacccgtcgcttcctgtgctac
aacatgattggctccgtcgtgagcactggtgagcccggaggtgatttcaactcggtggag
atggccttccacgacaccagccgtggtggtcgtatccccaccatcaccgactaccacggg
tactccgtcggatgcctgggtgagcggggctgtgcgctcgcctctcccgccaagcagagc
ggcggttcttccgtcctcttctatcgcccctacgagtcctggacgcacaagagtgattgg
tccgtcactctccccgtgggtgaggacgtggtgtccgtcgcgaccggcaaggactgggtc
gcggcgctgacatccggccgcatgcttcgcgtcttctcgcacgcgggcgctcagcggcag
atggtgcagctcgacggtgcgcccgtcaccgccgccggcaagggcgactccctcgtcgtc
gcctggcacgcctcggcgccggcgctcgtccccgacgcagccgatcccaaggtgcttcgg
gtcgagccgcgcatcgagttcgccgagtacgacgtggcgagcggcggtaaggtgctgagc
aagggtaggatcccgctaccccccggcgcgaccctgacgtggctcggtcacgtcgaggac
ggtaacggcgccatcgcgtttggcgcaagcgacggatgcgttcgagtccggacctccgag
tttggcggctcctggactcccgtgttcaggtcccaggatgcgaggcagcaggagggcgag
catcactggaccgtcgccgtgtccgtcgcggagagcgctctctactgcgtcgtgggtggc
aacgccaacggaccggcggttcacccccgaccagtcctcacgcccctgccgcttggcatg
cccgtggcgctgccggactcctcttccggcgagctggaggacgccgcggcgcgcgcgcag
ctgtgcgtcgccctcgcctccgcggcagccgccggggataccgccgggttcagggacgac
gtcgaccccgccggcgccgccatggacgccctccgcgccgcgcagaccgaggcggacaag
gccctactccgactcttccacgccgcgtgcaagggcgagaggcccgcgcgcgccgcggac
gtcgcatccgcgctcaatctcaccacgtcgatgcacggcgcccttaagctcgccaacgcc
atgtctcaaaacgttctcgccgagcgcgtcaccaacctcatcgaggcgagcatggccgcc
gccgcggcagcggctgaggtggaggcggcgagggtctacggaggcgccgtcgagctcgac
acgccggggcaggcgccccagcagcactactcgcagcccgcggcgtacgtcgcgccctcc
caggcgacgcagccggagaaggattccaaccctctcggccgccgcaggtccgtggcgccg
gcgactgacgagaacgcggacgcccccaaggttagcgccaaggtcaaggctggttacgag
gcgaacgccgcgccggcgaagaagggcagggtggcgaaccccttcgcgcgcgctcgatga

DBGET integrated database retrieval system