KEGG   Micromonas commoda: MICPUN_62211Help
Entry
MICPUN_62211      CDS       T02695                                 

Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mis  Micromonas commoda
Pathway
mis00330  Arginine and proline metabolism
mis01100  Metabolic pathways
mis01110  Biosynthesis of secondary metabolites
mis01230  Biosynthesis of amino acids
Module
mis_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MICPUN_62211
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     MICPUN_62211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored SHOCT NINJA_B NAD_binding_2 GvpG RNA_pol_Rpc4 PI3K_1B_p101
Motif
Other DBs
NCBI-GeneID: 8246906
NCBI-ProteinID: XP_002508910
JGI: MicpuN3_62211
UniProt: C1FHV6
LinkDB All DBs
Position
10:complement(1151806..1153308)
Genome map
AA seq 500 aa AA seqDB search
MSSLTRTGGLQSTVAQSRDPSTMTALGSTLTMLYALGQSSLARYNRANPRASTRGYARPL
KLPRFRATAARAAAADTQTRIGFIGAGSMAEAMARGFVQGGVATASDISVSPSTDPSRNA
SWSEDVGANVLGSNVEVMESSDVVFLTVKPHVLPAVLDEIADVVDPSRHLLVSVAAGVPV
EFIEKTLRKATEKKNKKNTKEMRVTVVDHGDAMDGMDEDSDSDDEDEMDDETKMKMKEEK
KKRKQLKKLKSLLEDGVITRDEFEAKSAAVGPPDPTIMPVETEEERKLRKEQKKAMKMQE
KEEKKAMKMREKEEKKLAKEAEKDEKRRSRPRVVRVMPNTPCMVGAAASVACVGDDPADP
MLAAADLDGVVRLMRGCGECVVVPERLMDAVTGVSGSGPAYVFQFIEALADGGVAAGLPR
ADANLLAAQTVMGASKMVLETGSHPGELKDKVCSPGGTTIRGVHELEKGGMRATVMSAVV
AAAARSVELGKSSKEKEKKK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgctgactcggacgggcgggctgcagtcgactgtcgcgcagagccgcgacccg
tcgacgatgactgcactcggatccacactcacgatgttatacgcgctcggacagtccagc
ctcgcgcgctataaccgcgccaacccgcgcgcgtccacacgcggttacgcgcggcccttg
aagctacccaggttccgcgcgaccgcggcgagggctgccgcggcggatacccagacgcga
atcgggttcatcggcgccgggtccatggcggaggcgatggcacgggggttcgtacaaggc
ggcgtcgcgaccgcatcggacatctccgtgtcgccgtccaccgacccgtctcgcaacgcg
tcctggagcgaggacgtgggggcgaacgtcttgggttccaacgtggaggtgatggagtcg
tcggacgtcgtgttcctgaccgtcaagccccacgttctgcccgccgtgctggacgagatc
gccgatgtggtggacccgagccgtcacctgctcgtctcggtggccgcgggggtccccgtc
gagttcatcgaaaagacgctccgcaaggcgacggagaagaagaacaagaaaaacacgaag
gagatgagagtgacggttgtcgaccacggcgacgcgatggacggcatggatgaagattcg
gactccgacgacgaggacgagatggacgatgaaacgaagatgaagatgaaggaggagaag
aagaagcgcaaacagctgaagaagctgaagagtctcctggaggatggcgtcatcacgcga
gacgagtttgaagccaaatccgcagccgtcggaccgcctgacccgaccatcatgccggtg
gaaacggaggaggagcgcaagcttcgcaaggagcagaaaaaggcgatgaagatgcaggag
aaggaggagaaaaaggcgatgaagatgcgggagaaggaagagaagaaactcgcaaaggag
gcggagaaggatgagaaacggaggtctcgcccgagagtcgtgcgcgtcatgcccaacacg
ccttgcatggtcggcgccgcggcgtcggtcgcatgcgtgggtgacgatcccgcggatccc
atgctcgcagccgcagacctcgacggtgtcgttcgactcatgcgcggttgtggcgagtgc
gtcgtggtcccggagaggctcatggacgccgtcaccggagtgtcgggctcgggacccgcg
tacgtcttccagttcatcgaggcgctcgccgacggcggcgtcgccgcgggtctgccgaga
gccgacgctaaccttctcgccgctcaaacggtcatgggagcgtctaagatggtgttggag
acgggatcgcaccccggtgagctcaaggacaaggtttgctcgccgggaggcacgactatt
cgaggggtgcacgagctcgagaagggaggcatgcgcgccacggtcatgagcgcggtcgtg
gcggcggcggcgcggtccgtagagctgggcaagtcgagtaaggaaaaggagaagaagaaa
tag

DBGET integrated database retrieval system