KEGG   Micromonas commoda: MICPUN_63548Help
Entry
MICPUN_63548      CDS       T02695                                 

Definition
(RefSeq) set domain protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mis  Micromonas commoda
Pathway
mis00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    MICPUN_63548
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mis03036]
    MICPUN_63548
Enzymes [BR:mis01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MICPUN_63548
Chromosome and associated proteins [BR:mis03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MICPUN_63548
   Polycomb group proteins
    PRC2-EZH2 complex
     MICPUN_63548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 8248405
NCBI-ProteinID: XP_002505475
JGI: MicpuN3_63548
UniProt: C1EG84
LinkDB All DBs
Position
13:381086..384406
Genome map
AA seq 1106 aa AA seqDB search
MAPATGMTRRETGVPQQRHASAPASTADETAMTGNDGSTDFDLALESNEVLAAMDDAAFT
RAVTRCLASHRKIFSAQQNNWASVRLAANLAPTLRGVAAEDAKRQDRATARAADAIADRA
NPDDPGEWRTSDPNRDPDVATVVVRRWENGASSGSTEEILQCLTETLPAIRNVPPYTSYI
YSAHENSYVQDEVRRRLMLRDNEGELYHELSDSDASESDSGSSQRRSDVEGLGDDDDGTE
RRARRRTARAGKKERVAARLGKAKPSEEYVEEAAANHGPIDEAEAKQKADEAAANRHWDK
RTDYLIYAAAVCLGTTTRCIEAVAANLRLEPRILRARMRTLQKARNARGGEKNERIDRRG
VSIAAVHEGAKAAHEAGVRAAQEYRAALAVAKGDAKVGEEEGDVEIKMDPGSDEEEDGVG
EEEGEEGTGSGGKEREKANEKDGGDDAGPAITRRATRGMADASVVPVRRKDSRETKLWNL
VAWRFLSEPDSTEDVHGGGLPRHADVDPALDSFRTLYCPRCHHYDCNLHGCGHAQPTVKL
GEEEASRNPHHRSKTHMEAVRRAAKEAEEAAAAAAAAAATGRKTRGQIDRPALAQPPCGP
RCWLMDASARGNASARGNASADAPTGASPIRFDAARIKREAGEAATARAEKAKAAPRRSP
RGTPQKQTTNTPRKSPRVGGGEGPAAGDADAAEAEVDFLNERPVSGGVDADAVVSTPVRQ
TDPKPAPRWSSFDESYYAKMRVVYGDGGDPCAIARAIDGPSCVEVYRRLRADLQREGEAE
ASRSEHHSDAEDEEGRGGGGGRGGNRRKGGKKRKGWITQRKRTTTAVIRRRMQGNEEDHV
WTQYTPCDCGPGGCKAATCACMSDGNFCEKYCSCRGPLSRCANAFTGCNCRSGTCGTRAC
PCFAAARECDPEICKRCAHTAQVIAHERRDGWPFTDICEPVPAPPKEPTEATAARSDPNE
QCGNMKLYLRQHKHACLGLSGVEGWGCFLKNGARKNELLGEYTGELISQTEADRRGKIYD
KLNSSFLFNLNDQWVLDAAVRGNKLKFANHSATPNCYAKVLMVRGDHRVGIFAKEHIAPG
EELTYDYRYEVDKAPDWALKPTEMED
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgcgacggggatgacgaggcgggagaccggggtgccgcaacaacgccacgcg
agcgcccccgccagcacggcggatgagacggcgatgaccggaaatgacggctccaccgac
ttcgatctcgcgctcgagtccaacgaggtactcgcggcgatggacgacgccgcgttcacg
cgcgcggtcactaggtgcctcgcctcgcatcgcaaaatcttcagcgcgcagcagaacaac
tgggcgtccgtccggctcgccgcgaacctcgcgccgaccctgcgcggcgtcgcggcggag
gacgccaaacgccaagatcgcgcgacggcccgcgcggcggacgccatcgcggatcgcgcc
aatcccgacgacccgggcgaatggcgaacgtcagatcccaaccgcgatccggacgtcgcg
accgtggtggtgaggcgctgggagaacggagcctcgtcgggttcgaccgaggagatcttg
caatgcctcaccgagaccctgcccgctatcagaaacgttccgccgtacaccagctacatc
tacagcgcgcacgagaactcctacgtccaggacgaggtccgtcgccggctcatgctccgc
gacaacgagggcgagctctatcacgaactctccgactctgatgcgagcgagtcggactcg
gggtcgtcccagcgccgatccgacgtcgagggcctgggcgacgacgacgacggcacggag
cgacgcgcgaggcggcggaccgcgcgcgcggggaagaaggagcgcgtcgccgcgaggctg
ggcaaggctaagccctcggaggagtacgtcgaggaagccgccgcaaatcacggaccgatc
gacgaagccgaggcgaaacaaaaggcggatgaagccgcggcgaatcgacactgggacaag
cgcaccgattacctcatctacgccgccgccgtgtgcctcggaaccacgacgcggtgcatc
gaggcggtggcggcgaacctgcgtttggagccgaggatcttacgcgcgaggatgaggacg
ctccaaaaggctcgaaacgcgcgcggcggagaaaagaacgaacgaatcgaccggcgcggc
gtctcgatcgcggctgttcacgagggcgcgaaggcggcgcacgaggctggggtacgcgcc
gcgcaggagtaccgcgcggcgctcgcggtggccaagggagacgcgaaggttggcgaggag
gagggtgacgtggaaatcaagatggacccgggctccgacgaggaggaggacggggttggg
gaggaagagggggaggaagggacgggatccggcggcaaagagcgcgagaaggcgaacgaa
aaggacggcggggacgacgccggacccgcgatcacgcggcgagcgacccgcggcatggcg
gacgcgtccgtcgttcccgttcgtcgcaaggattctcgcgagacaaagctgtggaacctc
gtggcgtggcggtttctctcggaaccggactcgacggaggacgtccacggcggcggcctc
ccgcgacacgccgacgtggaccccgcgctggattccttccggacgctgtactgcccgagg
tgccaccactacgactgtaacctgcacggctgcgggcacgcgcagccgacggtgaagctc
ggcgaggaggaggcgagcagaaacccgcaccatcgaagcaagacccacatggaggcggta
cgacgcgcggcgaaggaggcggaggaggcagcggccgccgccgcagccgccgccgcgact
gggcgcaagacgcgcggccaaatcgatcgccccgcgctcgctcaacccccgtgcgggccc
cggtgttggctcatggacgcctcggcccgcgggaacgcctcggcccgcgggaacgcctcg
gccgacgcgcccaccggcgcctctcccatccgcttcgacgcggcgaggatcaagcgcgag
gcgggcgaggccgcgacggccagggcggagaaggcgaaggccgcgccgcggaggtcacct
cgaggcacgccccagaaacaaacgacgaacactccccggaagtcccctcgcgtcggcggc
ggcgagggcccggcggccggcgacgcggacgcggccgaggcggaagttgactttctcaac
gaacgccccgtgtccggcggcgtcgacgccgacgcggtggtctccacgccggtcagacag
acggaccctaagcccgccccgcgctggtcctcctttgacgagtcgtactacgcgaagatg
agggtggtgtacggcgacggcggcgacccgtgcgccatagcccgcgccatcgacggacct
tcgtgcgtcgaggtgtatcgacggctccgcgcggaccttcaacgcgagggcgaggcggag
gcgtcgcggtcggagcaccatagcgacgccgaggacgaggagggacggggcggcggcggc
ggtcgcgggggcaatcggaggaagggcgggaagaagagaaagggttggatcacccagcgc
aagcgaacgacgaccgcggtgattcgccggcggatgcaagggaacgaggaggaccacgtg
tggacccagtacacgccgtgcgattgcggtccggggggctgcaaagcggcgacgtgcgcg
tgcatgagcgacgggaacttttgcgaaaagtactgcagctgccgcgggccgctctcgcga
tgcgccaacgcgtttacggggtgcaactgcaggagcgggacgtgcgggacgcgcgcgtgc
ccgtgcttcgccgccgcgcgcgagtgcgaccccgaaatctgcaagcgttgcgcgcacacc
gcgcaggtcatcgcgcacgagcgccgcgacgggtggccgtttaccgacatctgcgagccc
gtgcccgcgccgccgaaggaaccaaccgaggcgaccgccgccaggagcgatcccaacgag
cagtgcggcaacatgaagctctacctccggcagcacaagcacgcgtgcctcggtttgtcg
ggcgtcgaaggatggggatgctttttgaagaacggcgcgcggaagaacgagctcctcggc
gagtacaccggcgagctcatatcgcagacggaggcggaccgacggggtaagatttacgac
aagctcaactccagcttcctgttcaaccttaacgaccagtgggtgctggacgcggcggtt
aggggcaacaagctcaagttcgcgaaccactccgcgacgccaaactgctacgcgaaggtt
ctcatggtccgcggcgatcacagggtgggcatcttcgccaaggagcacatagcgccggga
gaggagctcacgtacgactacaggtacgaagtagacaaggccccggactgggccctcaag
cctaccgagatggaggactga

DBGET integrated database retrieval system