KEGG   Micromonas commoda: MICPUN_78711Help
Entry
MICPUN_78711      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mis  Micromonas commoda
Pathway
mis03030  DNA replication
mis03410  Base excision repair
mis03420  Nucleotide excision repair
mis03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mis00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MICPUN_78711
   03410 Base excision repair
    MICPUN_78711
   03420 Nucleotide excision repair
    MICPUN_78711
   03430 Mismatch repair
    MICPUN_78711
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mis03032]
    MICPUN_78711
   03400 DNA repair and recombination proteins [BR:mis03400]
    MICPUN_78711
Enzymes [BR:mis01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MICPUN_78711
    6.5.1.6  DNA ligase (ATP or NAD+)
     MICPUN_78711
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MICPUN_78711
DNA replication proteins [BR:mis03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MICPUN_78711
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MICPUN_78711
DNA repair and recombination proteins [BR:mis03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MICPUN_78711
   NER (nucleotide excision repair)
    Other NER factors
     MICPUN_78711
   MMR (mismatch excision repair)
    Other MMR factors
     MICPUN_78711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 8241416
NCBI-ProteinID: XP_002500226
JGI: MicpuN3_78711
UniProt: C1DYT3
LinkDB All DBs
Position
2:complement(1432287..1434317)
Genome map
AA seq 676 aa AA seqDB search
MAAATKKTAGAKKKKGKAKETAGKEGIGDKAVEAAGRLLKHDPDSGVDGWKKGEPVPYLF
LANVFENISETTKRLEIAEMLTNAFRTVIVSNPDDLLAAVYLASNTIAPQHEGIDLGIGD
ATLVKILAEATGRKESAIRADYKEQGDLGIVASMSRSTQKTMFAPPKLTMSGVLKEFRAI
ATTEGTKSVDAKKAKIKKLLVAARECEAGYIVRSLQGKLRIGLAQQTVNQALIHAVVLQS
DAAAKAAKEGGNGAVADLLGRGADVLKQVFSECPSYDEIVPALLMEGGVDKLHSRCHFRP
GVPVKPMLAKPTCGVSEVLQRFSDVEFTCEYKYDGERAQIHLLEDGTVKIFSRNQEDNTP
KFPDVIRALPSYLKAGVKSVVIDGEAVAYDREQHKILPFQILSTRGRKNIDEADIKVNVC
IYAFDCLYLNGETLLQKSLTERREAMYSAFKEVPDEFYFCTAKISRDVEELQVFLEDSIA
DNTEGLIVKTMDATYEPSKRSLNWLKLKKDYLEGCGDSLDLVPIGAFHGRGKRTGVYGAY
LLACYDEESEELQSICKIGTGFSDEQLVELTEGLRPTVIEAPRSYFKYDANAMKCDVWFD
PSQVWEVKAADLSISPVHQAGHGLVDPVKGIALRFPRFLRKRDDKNVEQATNSEQVADFY
NAQATKQEFAGGDDDY
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgaccaagaaaaccgccggcgccaagaagaagaagggcaaggccaaggaa
acggccggaaaggagggcatcggggacaaggccgtcgaggcggcgggcaggctcctcaag
cacgacccggattccggcgtggatgggtggaagaagggcgaacccgtgccgtatctcttc
ctcgcaaacgttttcgagaacatctcggagacgaccaagcgcctggagattgccgagatg
ctcacgaacgcgttccgcacggtcatcgtgtccaatcccgatgacctactcgccgccgtg
tacctcgcgagcaacaccatcgcgccgcagcacgagggtatcgatctcggcatcggcgac
gcgacgctcgtgaagatcctcgccgaggcgaccggccgcaaggagagcgccatcagagcc
gactacaaggagcaaggggacctagggatcgtggcgagcatgagcaggagcacgcagaag
accatgttcgcaccaccgaagctcaccatgtcgggcgtgctcaaggagttccgcgccatc
gccaccaccgaaggcaccaagtcggtagatgcaaaaaaggccaagattaaaaaactcctc
gtcgccgcgcgggagtgcgaggctggttacatcgtccgctcgctgcagggcaagctccgc
atcggcctcgcgcagcagaccgtcaaccaggctttgatccacgctgtggtgctccagtcc
gacgcggcggcgaaggctgcgaaagagggcggcaacggcgcggtggctgaccttctcggg
cggggcgccgacgtcctcaagcaggtcttctccgagtgcccctcctacgacgagatcgtc
cccgcgctgctcatggagggcggcgtggacaagctccactcgcggtgccacttcaggccg
ggcgtgcccgtgaagcccatgctcgccaagcccacgtgtggcgtgagcgaggtgctccag
aggttctcagacgtcgagtttacgtgcgagtacaagtacgacggggaacgtgcgcagatc
cacctgttggaggacggcaccgtcaagatcttctccaggaaccaggaggacaacacccca
aagttcccggacgtcatccgcgcgctgccctcgtacctgaaggctggtgtgaagagcgtc
gtgatcgatggagaggcggtggcgtacgacagggaacagcacaagattcttccgtttcag
attttgtccacgcgcgggcgcaagaacatcgacgaggcggacatcaaagtcaacgtgtgc
atatacgcgttcgactgcctctatctcaacggcgagacgttgctgcagaagtcgctgacg
gagagaagggaggcgatgtactcggcgttcaaggaggttcccgacgagttttacttttgc
acggcgaagatctcgcgcgacgtcgaggagctccaggttttcctcgaagattccatcgcc
gacaacaccgagggcctcatcgtcaagacgatggacgccacgtacgagccctccaagcga
tcgctcaactggctgaagctcaagaaggattacctcgagggatgcggcgactccctcgac
ctcgtccccatcggtgcgtttcacggccgaggcaagcgcacgggcgtctacggcgcgtac
ctgctcgcgtgttacgacgaggaatccgaagagttgcagtccatctgcaagatcggcacc
gggttctcggacgagcagctggtggagctgacggaaggtttgcgaccgacggtgatcgag
gcgccgaggagctacttcaagtacgacgccaacgccatgaagtgcgacgtgtggttcgac
ccgagccaggtttgggaggtgaaggcggcggacctgagcatctcgcccgtgcaccaggcg
ggacacgggctggtggacccggtcaagggcatcgcgctcaggttcccgcgtttcctccgc
aagagggacgataagaacgtggagcaggcgaccaactcggagcaggtggcggacttctac
aacgcgcaggcgaccaagcaggagtttgccgggggcgacgacgactattag

DBGET integrated database retrieval system