KEGG   Micromonas commoda: MICPUN_82879Help
Entry
MICPUN_82879      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mis  Micromonas commoda
Pathway
mis00564  Glycerophospholipid metabolism
mis01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MICPUN_82879
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MICPUN_82879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 8244358
NCBI-ProteinID: XP_002503071
JGI: MicpuN3_82879
UniProt: C1E9G4
LinkDB All DBs
Position
6:complement(join(12335..12832,12869..14134))
Genome map
AA seq 587 aa AA seqDB search
MPEPALPSEPWADASVSAPSRREQLRKLRGNEEFDVLIIGGGATGAGAAVDAATRGLRTA
LIEGEDFGSGTSSRSTKLVHGGVRYLEKAVFQLSYGQLKLVFEALHERKNLLRNAPHLAR
PLPIATPCYHGWEVPYYWAGMKAYDLVAGASGLTMSGFRTAAESLALFPTLAAVRKEDGA
SLKGTIVYRDGQFDDARLNVALACTAAHAGAVAANYVKVTALVKDLRTGRVVGVKAKDVV
DGGREFEVRAKVVLNCTGPFTDAVRKMSDGSRMDIMTPAGGAHLTLPKHFAPDAEGLIVP
KTKDGRVVFMLPWLGGVIAGTTDALAPVTLRPRASADEVDFILDSIAPYLSVPATRADVT
SVWSGIRPLAADPTQSGTENVSRDHLVVDEGDGMVTVTGGKWTTYRLMAEHAVDAAIRAA
DKSMASRAGKCRTTDVAVVGAHGYSPDLHVRLLASKSSKSGAKSSKPAAPELEDAAVMSH
LAKSYGDRAPAIVELARSDPRRLARRIAGPNQPVIAAEVLHAARSEYCQTTCDFVARRTR
LAFLDVEAARVAVPEVNKLLAKELGWGSWRAARELKDANALLDTFTC
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaccggcgcttcccagcgagccttgggcggacgcgtccgtgtcggccccgtcc
agacgcgagcagcttcgcaagctgcgcgggaacgaggagttcgacgtcctcatcatcgga
ggcggcgctacgggcgcgggtgcggcggtcgatgccgccaccaggggcctgcgcacggcg
ctcatcgagggcgaagactttgggagcggcacctcctcgaggtccaccaagctcgtccac
ggcggcgtcaggtacctggagaaggccgtcttccagctctcgtacggtcagctgaagctc
gtctttgaggcactgcacgagagaaagaacctgctccgcaacgccccgcacctggcgcgt
cccctgcccatcgcgactccgtgctaccacggctgggaagtgccctactactgggccggg
atgaaagcctacgacctcgtcgcgggcgcctccgggttgaccatgtccggcttccgaacc
gccgccgagtccctcgcgctcttccccacgctcgccgccgtgcgtaaagaggacggcgcg
tcccttaagggaaccatcgtctacagagacggacaattcgacgacgcgaggctcaacgtc
gcgctggcgtgcaccgccgcgcacgcgggcgccgtcgccgccaactacgtcaaggtgaca
gccctggtgaaggacttacgcaccgggcgggtggtgggggtcaaggccaaggacgtcgtg
gacggcgggagggagttcgaggtacgggcgaaggttgtgctcaactgcacggggccgttc
accgacgccgtgcgaaagatgtccgacggatcaagaatggacatcatgacccccgcgggc
ggagctcacctgaccctccccaaacacttcgcgcccgacgccgagggtctcatcgtgccc
aagacgaaagacggtcgcgtggtgttcatgctgccctggctgggcggcgtcatcgcgggt
accaccgacgctctcgcgcccgtcacgctgaggccccgagcgagcgcggatgaggttgat
tttatcctcgactcgatcgcgccgtacctctccgtgccggcgacgcgcgcggacgtgacg
tcggtgtggtccggcatcagacccctcgccgcggacccgacccagagcggcaccgagaac
gtcagccgcgatcacctcgtggtggacgagggcgacgggatggtgacggtgacggggggc
aagtggacgacgtatcgactcatggctgagcacgcggtggacgccgccatccgagccgcc
gacaagagcatggcgagtagggccggtaagtgccggacgacggacgtcgcggtcgtcggc
gcgcacgggtactccccggaccttcacgtcaggttgctcgcctcaaagtcctcaaagtct
ggtgccaaatcatccaaacccgcggcgcccgagctggaggacgcggccgtcatgtcgcac
ctcgccaagtcgtacggcgaccgcgctccggccatcgtcgagctcgcgaggagcgacccg
cgtcggctcgcccgtaggatcgccggtcccaatcagccggtcatcgccgcggaggttttg
cacgcggcgcggtcggagtactgccagacgacgtgcgacttcgtggcgagacggacgcgg
ctggcgttcctggacgtggaggcggcgcgcgtcgcggtgcccgaggtgaacaagttgctc
gccaaggagctcggatggggatcgtggagagcggcgagggagctcaaggatgcgaacgcc
ttgctggacacgttcacgtgctga

DBGET integrated database retrieval system