KEGG   Micromonas commoda: MICPUN_91758Help
Entry
MICPUN_91758      CDS       T02695                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mis  Micromonas commoda
Pathway
mis04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mis00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MICPUN_91758
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MICPUN_91758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 8246945
NCBI-ProteinID: XP_002508398
JGI: MicpuN3_91758
UniProt: C1FI38
LinkDB All DBs
Position
10:join(190791..190849,190961..191507)
Genome map
AA seq 201 aa AA seqDB search
MAAVATSVNLSAKSALVGSKKVVTARAFAPASARRALVVEAADKKAVCVLTGTAGVEGVV
TFTQSGDGPTKVVGDLKGLAAGKHGFHIHEFGDTTNGCMSTGPHFNPHGKDHGAPTDENR
HAGDLGNVVATADGCTFEIEDVQIPLSGVNSIIGRACVIHELEDDLGKGDSSEIGTQGKT
SKTTGNAGARLACGVIALTPA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcgccacctccgtgaacctctccgccaagtccgcgctcgtcggctccaag
aaggtcgtgaccgcgcgcgcgttcgctcccgcgtccgcccgtcgcgctctcgtcgtcgag
gccgccgataagaaggccgtctgcgtcctcaccggcaccgcgggcgtggagggtgtcgtc
accttcacccagtccggcgacggtcccaccaaggttgtcggcgacctcaagggtctcgcc
gcgggcaagcacggcttccacatccacgagttcggcgacaccaccaacggctgcatgtcc
accggaccccacttcaacccgcacggcaaggaccacggcgcccccaccgacgagaaccgc
cacgcgggcgacctcggcaacgtcgtcgccaccgccgacggctgcaccttcgagatcgag
gatgtccagatccccctctccggagtcaactccatcatcggccgcgcgtgcgtcatccac
gagctcgaggacgacctcggcaagggcgactcctccgagattggcacccagggcaagacc
tccaagaccaccggcaacgcgggcgcgcgtctcgcgtgcggcgtcatcgcgctcaccccc
gcgtaa

DBGET integrated database retrieval system