KEGG   Micromonas commoda: MICPUN_97885Help
Entry
MICPUN_97885      CDS       T02695                                 

Gene name
AMY5
Definition
(RefSeq) glycoside hydrolase family 13 protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mis  Micromonas commoda
Pathway
mis00500  Starch and sucrose metabolism
mis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUN_97885 (AMY5)
Enzymes [BR:mis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MICPUN_97885 (AMY5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 8246213
NCBI-ProteinID: XP_002504668
JGI: MicpuN3_97885
UniProt: C1ECL9
LinkDB All DBs
Position
9:complement(868807..869997)
Genome map
AA seq 396 aa AA seqDB search
MLLQGFNWESSRIEGGGAWYRKMTEMAPRLAELGFTVVWLPPPTDSVSQEGYMPRDLYNL
NCKYGTKEELKQCIEALHRHGIKCLGDAVLNHRCAQFQGPDGLWNQYGGKLDWDARAIVS
DDPHFGGQGNQSSGDFFHAAPNIDHSQDFVKRDITEWMQWLQSEVGYDGWRLDYVRGFSG
KHVKTYMESTNVSFAVGEFWDTLEYDYDSPKYNQDAHRQRIIKWIDDAGGLAGAFDVTTK
GILHAVFERCEYWRLSDEDGQPPGVLGRWPSRAVTFIENHDTGSTQGHWRFPEGAEAQGY
VYILTHPGTPTVFWDHVYDWHDGSLAQDIRKLIAFRKECGIHCRSKVNILKAEAGVYAAQ
IDDRVVMKIGPDAFAPDETEWQYAMHGDNWCVWKHR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctccttcagggtttcaactgggagtcctcccgcatcgaaggtggcggcgcgtggtac
cgcaagatgacggagatggcgcccagacttgccgagcttggcttcaccgtggtgtggctc
cctccccccacggattctgtctcccaggagggttacatgccaagggacctgtacaacctg
aactgcaagtacggcaccaaggaggagcttaagcagtgcatcgaggctctgcacaggcac
ggcatcaagtgccttggtgacgccgtcctcaatcacaggtgcgcccagttccagggaccc
gacgggctctggaaccagtacggcggcaagcttgactgggacgcgcgcgccatcgtctct
gacgatccccacttcggcgggcagggcaaccagagcagcggggattttttccacgccgcg
ccaaacatcgaccactcccaggatttcgtcaagcgcgacatcaccgagtggatgcagtgg
cttcagtctgaggttggctacgacgggtggaggctcgactacgtgcgcggcttctccggc
aagcatgtcaagacctacatggaatccaccaacgtgagcttcgcggtgggtgagttttgg
gacaccctcgagtacgattacgactcccccaagtacaaccaggatgcgcacaggcagcgg
atcatcaagtggatcgacgacgcgggtggcctcgcgggtgcctttgacgtcaccaccaag
ggtatcctccatgccgtgttcgagcgctgtgagtactggaggctctccgacgaggacggt
cagccacccggcgtgctcggcaggtggccgtcccgtgcggtgaccttcatcgagaaccac
gacaccggatccacccagggacactggaggttccccgagggtgctgaggcacagggctac
gtgtacattctcacgcacccgggcacccccaccgtgttctgggatcacgtgtacgattgg
cacgacggcagcctggcgcaggacatccgcaagctcatcgcgtttaggaaggagtgcggg
atccactgtaggtccaaggtgaacatcctcaaagctgaggctggggtgtatgcggcgcag
attgacgaccgtgttgtgatgaagattgggcccgacgcgtttgcgccggatgagacagag
tggcagtacgccatgcacggagataactggtgcgtgtggaagcaccggtaa

DBGET integrated database retrieval system