KEGG   Mycobacterium intracellulare MOTT-02: OCO_03160Help
Entry
OCO_03160         CDS       T01754                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mit  Mycobacterium intracellulare MOTT-02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFC46680
LinkDB All DBs
Position
complement(324398..325453)
Genome map
AA seq 351 aa AA seqDB search
MPPVSPMLAKSVRAIPPHASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPELVAAV
RAELPERCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEATPASFIAFDLLALGGD
DYTRRPFSERRAALVDAVGGSGRSIHVTPATTDLGTAQRWFDEFEGAGLDGVIAKPLDVT
YQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIGAFPMA
ERRRLFAELQPLVTDFADHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVPLRPERVVEV
RYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFSLGEIVPGLGPG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgtcgccgatgctggccaagtcggttcgcgctatcccgccccacgcgtcg
tacgagcccaagtgggacggattcaggtcgatctgtttccgcgacggcgacgacgtcgag
ctgggcagccgcaacgagcggccgatgacccgctactttccggagttggtcgccgcggtc
agggccgagctgccggagcgctgcgtgatcgacggggagatcgtcatcgccaccgaccac
ggcctggacttcgaggcgctgcagcaacgcattcacccggccgactcgcgggtgcggatg
ctcgccgaggcgacgcccgcgtccttcatcgcgttcgacctgctggcgctcggcggcgac
gactacacccggcggccgttcagcgagcggcgggcggccctggtcgatgcggtgggcgga
tcgggtcgctcgatccatgtcacgcccgcgacgaccgatctgggcaccgcgcagcgatgg
ttcgacgagttcgagggcgccggcctcgatggcgtgatcgccaagcccctggacgtcacc
taccagccggacaagcgggtgatgttcaagatcaagcacgaacggaccgcggactgtgtg
gtcgccggctatcgggtccacaagtccggcgccgacgcgatcgggtcgctgttgctgggg
ctctaccaggacgacgggcagctggcctcggtcggcgtcatcggcgcgttcccgatggcc
gagcggcgccggctgttcgccgaactgcagccgctcgtcaccgacttcgcggaccatccg
tggaactgggccgcccacgaggccggcgagcggacgccccgcaagaacgaatactcgcga
tggaacgccggcaaggacctctcgttcgtgccgctgcggcccgagcgcgtggtcgaggtc
cgctacgaccacatggagggtcggcggtttcgccataccgcgcagttcaatcggtggcgt
ccggaccgcgacccgcgctcgtgcacctacgaacagctggaacagccggtgacgttcagc
ctcggcgagatcgtgccgggcctcggcccgggctga

DBGET integrated database retrieval system