KEGG   Mycobacterium intracellulare MOTT-02: OCO_04510Help
Entry
OCO_04510         CDS       T01754                                 

Definition
(GenBank) hypothetical protein
Organism
mit  Mycobacterium intracellulare MOTT-02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C PI31_Prot_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFC46815
LinkDB All DBs
Position
complement(451032..452045)
Genome map
AA seq 337 aa AA seqDB search
MRASVLRDGRMVYRDDVPDPIPEAGQVLVGVRACGICGSDLHFAAHGAQVLEMTERAAGG
GGGMHVDLDHDIFMGHEFSAEILEAGPDTETHPPGTLVTSLPVLLSAKGIEPIVYSNSTI
GGYSERMLLSAPLLLPVPNGLDFKHAALTEPMAVGLHAVNKSNVAPGETALVLGCGPIGI
AIVAALRSKGVETIVAADFSPKRRELATAMGAHQTLDPAQGSPFDSVKPAVVFEAVGVPG
IIDDVLLRARPGTRLVVAGVCMQPDTVHPFFAIAKEINVQFVLAYTPDEFGDSLRALADG
DIDVSPLITGEVGLDAVGAAFDDLADPERHCKVLVTP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctcggtgttgcgcgacggtcgcatggtctaccgcgacgacgtgcccgacccg
atccccgaagccgggcaggtgctcgtcggcgtgcgggcatgcggaatctgcggcagcgac
ctgcatttcgccgcccacggcgcccaggtgctggaaatgaccgaacgggcggccggtggc
ggcggtggcatgcacgtcgacctggaccacgacatcttcatgggtcacgaattcagcgcc
gagatactcgaagccggccccgacaccgagacccatccaccgggcaccctggtcacctcg
ctgccggtgctgttgtccgccaagggcatcgagccaattgtgtacagcaacagcacaatc
ggcggctactccgaacggatgctgttgtccgcgccgctgctgctgcccgtccccaatggc
ctggacttcaaacatgcagcactgaccgaacccatggcggtgggattgcatgccgtcaac
aagtccaacgtcgcgcccggggagacggccctggtactgggctgcggcccgatcgggatc
gccatcgtcgccgcccttcggtccaagggcgtcgaaaccattgtggcggcagacttttca
ccgaagcgacgggagctcgccaccgcgatgggagctcaccagacgctggatccggcgcag
ggctcgcccttcgacagtgtcaagcccgcggtggtgttcgaggccgtcggggtgcccggc
atcatcgacgacgtgctgctccgcgcgcggccgggcacccgactggtggtcgccggggtg
tgcatgcaacccgacacagtgcatcccttcttcgcgatcgccaaagagatcaacgtgcag
ttcgtgctcgcctacacccccgacgagttcggcgactcgctgcgcgcgctggccgacggc
gacatcgacgtcagcccgctgatcaccggcgaggtgggcctggatgcggtcggggcggcg
ttcgacgacctggccgaccccgagcggcactgcaaggttctcgtcacgccctga

DBGET integrated database retrieval system