KEGG   Mycobacterium intracellulare MOTT-02: OCO_17100Help
Entry
OCO_17100         CDS       T01754                                 

Definition
(GenBank) hypothetical protein
Organism
mit  Mycobacterium intracellulare MOTT-02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFC48073
LinkDB All DBs
Position
complement(1731783..1733249)
Genome map
AA seq 488 aa AA seqDB search
MTKNSDHRCYDEVFIGGQWRKPANPQQLEVISPHSEEPVGHVQAAGPEDVDAAVVAARHA
FDHGPWPRMSHADRMAKVEQLAAIYARHSDDMADLITDEMGSPRSFSRMGQGAAAASLIH
LALAAARDFPWTERRQGVLGEVHLRRAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVI
VKPAPETPLDALWLAEMIEQLDLPEGVVSVLPGGTDVGEALVRHPGVDKIAFTGSSAVGR
RIAALCGEQLKRVSLELGGKSAAIILDDADIDKTVAGLKSAGLMNNGQACVAQTRILVSD
RKHDEVVDALAGMMSALHVGDPADEATDIGPLVAQRQQCRVQDYIRSGRREGARVVLGGE
QSPSERGWYVQPTLFADATNDMRIAREEIFGPVLTVLRYRDEDDAIRIANETDYGLAGSV
WTSDIGHGLDVAAAVRTGTYGINMYTLDIGAPFGGFKQSGIGREFGPEGLHEYVELQTLI
CKGQLPPL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaattccgaccatcgttgttacgacgaagtgttcatcggagggcagtggcgc
aagcccgccaatccccaacagctcgaagtgatctcgccgcactccgaggagccggtcggt
cacgtccaggcggccggccccgaggacgtcgacgccgccgttgtcgccgctcggcacgcc
ttcgaccacggaccgtggccgcggatgagccacgccgatcggatggccaaagtcgaacag
ctcgccgcgatctacgcccgccacagcgacgacatggccgacctgatcaccgacgagatg
ggatcaccgcgcagtttcagccggatgggccagggggcggccgccgcgtcgctgatccac
ctcgcgctggccgccgcccgcgactttccgtggaccgaacgccgccagggcgtgctcggc
gaagtgcacctgcgccgggccccggttggggtggtgggcgcgatcgtgccctggaacgtg
ccccagtttttgatcatgcccaagctgatccccgcgctcatcgcggggtgcacggtgatc
gtcaagcccgcacccgaaacgcctttggacgctttgtggttggccgagatgatcgagcag
cttgacctgcccgagggcgtggtctcggtgctgcccggcggcaccgacgtcggcgaggcg
ctggtgcgccaccccggcgtggacaagatcgcgttcaccgggtccagcgccgtcgggcgc
cggatcgccgcgctgtgcggggaacaattgaaacgcgtgagcctggagctgggcggcaag
tcggcggcgatcatcctcgacgacgccgacatcgacaagaccgtggccgggttgaagagc
gcgggcctgatgaacaatggccaggcctgcgtcgcccagacccgcatcctggtcagcgac
cgcaagcacgacgaggtcgtcgacgccctggccggcatgatgtcagcgctgcacgtcggt
gacccggccgacgaggcaacggacatcggaccgcttgtcgcccaacgccaacagtgccgc
gtccaggactacatccggtccgggcgccgcgaaggggcccgcgtcgtcctgggtggcgaa
cagagcccgtccgagcgcggctggtacgtgcagccgacgctgttcgccgacgccaccaat
gacatgcgcatcgcccgggaggagattttcgggccggtgctcacggtgctgcgctaccgg
gacgaggacgacgcgatccgcatcgccaacgagaccgactacggtctggccggttcggtg
tggacgtccgacatcgggcacggcctcgacgttgcggccgccgtccgcacggggacctac
ggcatcaacatgtacaccctcgacatcggggcaccgttcggcggtttcaagcaatccggc
atcgggcgggagttcggccccgagggtctgcacgagtatgtcgaactgcagacgctgata
tgcaaagggcagttgccacccctatga

DBGET integrated database retrieval system