KEGG   Mycobacterium intracellulare MOTT-02: OCO_29900Help
Entry
OCO_29900         CDS       T01754                                 

Definition
(GenBank) putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mit00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    OCO_29900
Enzymes [BR:mit01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OCO_29900
DNA repair and recombination proteins [BR:mit03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     OCO_29900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S Alpha_TIF
Motif
Other DBs
NCBI-ProteinID: AFC49353
LinkDB All DBs
Position
3174519..3175409
Genome map
AA seq 296 aa AA seqDB search
MARVDVEITHPDRVLFPADGITKRDLAAYYDQVADTMLAHLRGRALNVQRYPRGIAETGF
IQQDFADSLPDWMSSVRVPKEGGTVEHPVVERPEALRWLANQSCITLHMWQSRRARLDHP
DRLVFDLDPADGDFAVVRATARATAGVLGDLGLACYVQTTGSRGLHVVTPLRADADFDTA
RQFARDVSEVVAADDPAHRTVEARKDKRDGRVYLDIMRNAYAQTAVAPYSVRARNGAPVA
TPLEWDELDAGRLRADRFTIRDVPKRLAGQPDPWAHMSRHARSLAGPLRRLARLRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgtcgacgtcgagatcacccacccggaccgcgtcctgtttcccgccgacggg
atcaccaaacgcgatctcgccgcctactacgaccaggtggccgacaccatgctggcgcac
ctgcggggccgggccctcaacgtgcagcgctatccccgaggcatcgccgaaacagggttc
atccagcaggatttcgccgattcgctaccagactggatgagcagtgtccgggtgcccaag
gagggcggcaccgtagagcatccggtcgtcgaacggccggaggcgctgcgctggctggcc
aatcaaagctgcatcaccctgcacatgtggcagtcgcgccgggcccggctggaccacccg
gaccggctcgtcttcgatctcgacccggccgacggcgacttcgccgtggtgcgagcgacc
gcacgcgccaccgccggggtgctcggggacctgggcttggcgtgctacgtccagaccacc
ggctcgcgcgggctgcacgtcgtgactcccttgcgcgccgacgccgatttcgacaccgcc
cggcagttcgcccgcgacgtcagcgaagtggtcgccgcggacgatcccgcgcatcgcacc
gtcgaggctcgcaaggacaagcgcgacgggcgggtatacctcgacatcatgcgaaacgcc
tacgcgcagacggcggttgcgccgtattcggttcgggcccgcaacggcgcaccggtagcc
acaccactggaatgggacgagctggacgccgggcggttgcgggccgatcggttcaccatc
cgagacgtgcccaaacggcttgccggacaaccggatccgtgggcgcacatgtcgcggcac
gcccgctcgctggccggcccgctgcggcgattggcgaggctacgtgcctga

DBGET integrated database retrieval system