KEGG   Mycobacterium intracellulare MOTT-02: OCO_32600Help
Entry
OCO_32600         CDS       T01754                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01130  Biosynthesis of antibiotics
mit01230  Biosynthesis of amino acids
Module
mit_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCO_32600
Enzymes [BR:mit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     OCO_32600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin AAA_24 Cytidylate_kin2 AAA_17 AAA_5 AAA_22 AAA KTI12 Mg_chelatase MMR_HSR1 AAA_16 6PF2K AAA_28 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: AFC49623
LinkDB All DBs
Position
complement(3513291..3513815)
Genome map
AA seq 174 aa AA seqDB search
MAPKAVLIGLPGSGKSTIGRRLAKALDVGFLDTDAAIEQRTGRRIDEIFATDGEREFRRI
EEDVVRAALADHDGVLSLGGGAVTSPGVREALAGHTVVYLEISATEGVRRTGGNTVRPLL
AGPDRADKYRALMAERSPLYRRAATIRVDTNRRNPGAVVRYIVSRLQAPAGAAT
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaagcggtcctgatcgggttgccggggtcgggcaagtccaccatcgggcgc
cggctcgccaaggcgctcgacgtcggcttcctcgacaccgacgcggcgatcgagcagcgg
accgggcggcgcatcgacgagatcttcgcgaccgacggcgaacgggaattccggcgcatc
gaagaggacgtggtgcgcgccgcgctggccgaccacgacggcgtgctgtcgttgggcggc
ggcgccgtcaccagccccggcgtccgcgaggcgctcgccggccacaccgtcgtctacctg
gagatcagcgccaccgaaggcgtccggcgcaccggcggcaacacggtgcgcccgctgctg
gccgggcccgaccgcgccgacaaataccgcgcgctgatggccgaacgcagtccgctgtat
cgccgggcggcgaccatccgcgtcgacaccaaccgccgcaaccccggcgcggtggtccgc
tacatcgtctcgcggttgcaggcaccggcgggggcggccacgtga

DBGET integrated database retrieval system